LXL04_023964 | RubberDandelionOmics

Gene overview

LXL04_023964

Reference: OH-1004 Chr: Chr05 Coordinates: 75775742-75776773 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · LXL04_023964|LXL04_023964|OH1004|cDNA

ATGAGAAGTATAACGATATCGAGCAACAATGTGTTTACTGGCTTGATGAAGATCAAAGCCGCAAGTCGCCATATTTTCGACCGTACTATTTTTCATACCATTCTTATTCTAGCTTTCTATTGCCCTTTGTTTTCATCCAAGGATTATGACAAGGCTGCAATCGAGTGTAATGGAAGAGAAGCTGTCACCAACTTTGAAGCCAGTACTTACCAAGGAAACGACAATATTGCTTCAAATCATCATGCAAATGGAGGTCACTG...

CDS

Download CDS FASTA

360 bp · LXL04_023964|LXL04_023964|OH1004|CDS

ATGAGAAGTATAACGATATCGAGCAACAATGTGTTTACTGGCTTGATGAAGATCAAAGCCGCAAGTCGCCATATTTTCGACCGTACTATTTTTCATACCATTCTTATTCTAGCTTTCTATTGCCCTTTGTTTTCATCCAAGGATTATGACAAGGCTGCAATCGAGTGTAATGGAAGAGAAGCTGTCACCAACTTTGAAGCCAGTACTTACCAAGGAAACGACAATATTGCTTCAAATCATCATGCAAATGGAGGTCACTG...

Protein

Download Protein FASTA

119 aa · LXL04_023964|LXL04_023964|OH1004|PROTEIN

MRSITISSNNVFTGLMKIKAASRHIFDRTIFHTILILAFYCPLFSSKDYDKAAIECNGREAVTNFEASTYQGNDNIASNHHANGGHCMDFLEDEVVEILVEYGVDPHEYGFGFRIRYFS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023964`
TK1151 ID	TkA04G503310
OH-1004 ID	LXL04_023964
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.800
Protein coverage (%)	TK1151 12.808 / OH-1004 21.849 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023964

Location Chr05:75775742-75776773 (-)

Description Similar to GAUT14: Probable galacturonosyltransferase 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15470`	May be involved in pectin and/or xylans biosynthesis in cell walls (By similarity).	Arabidopsis galacturonosyltransferase (GAUT) 13 and GAUT14 have redundant functions in pollen tube growth.2013 · DOI: 10.1093/mp/sst084
`At3g01040`	May be involved in pectin and/or xylans biosynthesis in cell walls (By similarity).	Arabidopsis galacturonosyltransferase (GAUT) 13 and GAUT14 have redundant functions in pollen tube growth.2013 · DOI: 10.1093/mp/sst084
`At2g28550`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0121600`	Probable transcription factor (By similarity).	Coexpression analysis identifies Rice Starch Regulator1, a rice AP2/EREBP family transcription factor, as a novel rice starch biosynthesis regulator.2010 · DOI: 10.1104/pp.110.159517
`UniProt: B8AXC3`	Probable transcription factor (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023964 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010581 regulation of starch biosynthetic process Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT2G28550

ath:AT3G01040

ath:AT5G15470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.267

Rank 1 · LXL04_023964 · OH-1004

Nucleus0.234

Rank 2 · LXL04_023964 · OH-1004

Mitochondrion0.151

Rank 3 · LXL04_023964 · OH-1004

Plastid0.146

Rank 4 · LXL04_023964 · OH-1004

Cell membrane0.118

Rank 5 · LXL04_023964 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWT1`	Arabidopsis thaliana	Probable galacturonosyltransferase 14	72.093%	Swiss-Prot	weak database homology
`Q0WV13`	Arabidopsis thaliana	Probable galacturonosyltransferase 13	72.093%	Swiss-Prot	weak database homology
`Q9SK03`	Arabidopsis thaliana	Ethylene-responsive transcription factor RAP2-7	60.526%	Swiss-Prot	weak database homology
`Q2TQ34`	Oryza sativa subsp. japonica	APETALA2-like protein 1	75.000%	Swiss-Prot	weak database homology
`B8AXC3`	Oryza sativa subsp. indica	APETALA2-like protein 1	75.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card