LXL04_022745 | RubberDandelionOmics

Gene overview

LXL04_022745

Reference: OH-1004 Chr: Chr05 Coordinates: 7302269-7306161 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2374 bp · LXL04_022745|LXL04_022745|OH1004|cDNA

ATTACTCCCGTTCATCTCAACGACCCTCTCCAAATCTTTGATCAAGCATCCCAATCAGACAACAAACTTATATAAACAAGAATCACATTACTCTCTCACTTCCCGCAAACTTCTCTCTCTAAAAATACACATGGCTGCGTCTTCTTTCGCTCTCTCCCAAGCTGCCACCACCCTCTCTCGCGCCGCCGCTCTCCGCCATGACTCTTCCACTACCACCACCCAACAACCATCTTCCATATCGACCCTCTCGATCCCCTCTT...

CDS

Download CDS FASTA

2337 bp · LXL04_022745|LXL04_022745|OH1004|CDS

TTGATCAAGCATCCCAATCAGACAACAAACTTATATAAACAAGAATCACATTACTCTCTCACTTCCCGCAAACTTCTCTCTCTAAAAATACACATGGCTGCGTCTTCTTTCGCTCTCTCCCAAGCTGCCACCACCCTCTCTCGCGCCGCCGCTCTCCGCCATGACTCTTCCACTACCACCACCCAACAACCATCTTCCATATCGACCCTCTCGATCCCCTCTTTTTCCGGCCTTAAATCCACCTCAACTCCCTCCTCAAG...

Protein

Download Protein FASTA

778 aa · LXL04_022745|LXL04_022745|OH1004|PROTEIN

MIKHPNQTTNLYKQESHYSLTSRKLLSLKIHMAASSFALSQAATTLSRAAALRHDSSTTTTQQPSSISTLSIPSFSGLKSTSTPSSSAVAPRRASASRRRIISSAAVETLEKTDMSLVDKSVNTIRFLAVDAVEKANSGHPGLPMGCAPMGHILYDEVMKYNPKNPYWFNRDRFVLSAGHGCMLHYALLHLAGYDSVKEEDLKQFRQWGSKTPGHPENFETPGIEVTTGPLGQGIANAVGLAVAEKHLAARFNKPDATVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022745`
TK1151 ID	TkA06G456290
OH-1004 ID	LXL04_022745
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 99.744 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022745

Location Chr05:7302269-7306161 (-)

Description Similar to TKL-2: Transketolase-2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45290`	Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate (By similarity).	No verified direct reference in this release
`At3g60750`	Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022745 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006098 pentose-phosphate shunt Biological Process

GO:0009051 pentose-phosphate shunt, oxidative branch Biological Process

GO:0019253 reductive pentose-phosphate cycle Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0004802 transketolase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G45290

ath:AT3G60750

sot:102591899

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.937

Rank 1 · LXL04_022745 · OH-1004

Mitochondrion0.069

Rank 2 · LXL04_022745 · OH-1004

Cytoplasm0.043

Rank 3 · LXL04_022745 · OH-1004

Peroxisome0.027

Rank 4 · LXL04_022745 · OH-1004

Cell membrane0.014

Rank 5 · LXL04_022745 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00456.27Transketolase_N120-451 aa

PF02779.30Transket_pyr469-639 aa

PF22613.2Transketolase_C_1652-766 aa

PF02780.26Transketolase_C664-770 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022745	`PF00456.27`	Transketolase_N	120	451	3e-152	507.1
LXL04_022745	`PF02779.30`	Transket_pyr	469	639	1.1e-52	178.9
LXL04_022745	`PF22613.2`	Transketolase_C_1	652	766	1.6e-41	141.8
LXL04_022745	`PF02780.26`	Transketolase_C	664	770	4.4e-11	43.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IW47`	Arabidopsis thaliana	Transketolase-2, chloroplastic	79.228%	Swiss-Prot	strong database homology
`Q8RWV0`	Arabidopsis thaliana	Transketolase-1, chloroplastic	79.840%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card