LXL04_021760 | RubberDandelionOmics

Gene overview

LXL04_021760

Reference: OH-1004 Chr: Chr04 Coordinates: 136460448-136461809 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

780 bp · LXL04_021760|LXL04_021760|OH1004|cDNA

ATGCTCCTCCTCAGAGcaaccaccgccaccaccaccacggCCTCTCTCCCCCTCCCTCTCCTCACCATCTCCTCCAAGCTTTCTCTCTCTAAGCCCTCTTCCTTCCCTTTTACAGCCACGAAACCTCTCTTCACCCTCCGCCACTCCTCCTCCACCCCCAAAATCATGAGCTGGCTCGGAAAGCTAGGGTTCGGTACTCGCACACCCGCCGACGCATCCATGGACCAGTCCTCTATTGCTCAGGGCCCCGACGATGACCT...

CDS

Download CDS FASTA

780 bp · LXL04_021760|LXL04_021760|OH1004|CDS

ATGCTCCTCCTCAGAGCAACCACCGCCACCACCACCACGGCCTCTCTCCCCCTCCCTCTCCTCACCATCTCCTCCAAGCTTTCTCTCTCTAAGCCCTCTTCCTTCCCTTTTACAGCCACGAAACCTCTCTTCACCCTCCGCCACTCCTCCTCCACCCCCAAAATCATGAGCTGGCTCGGAAAGCTAGGGTTCGGTACTCGCACACCCGCCGACGCATCCATGGACCAGTCCTCTATTGCTCAGGGCCCCGACGATGACCT...

Protein

Download Protein FASTA

259 aa · LXL04_021760|LXL04_021760|OH1004|PROTEIN

MLLLRATTATTTTASLPLPLLTISSKLSLSKPSSFPFTATKPLFTLRHSSSTPKIMSWLGKLGFGTRTPADASMDQSSIAQGPDDDLPAPGQQFLQFGAGCFWGVELAFQRVPGVSKTEVGYTQGFLHNPTYNDVCSGTSMHSEVVRVQYDPKACSIDSLLDCFWERHDPTTLNRQGNDVGTQYRSGIYFYTPEQEKAAIESKERHQKKLNRTVVTEILPAKKFYRAEEYHQQYLAKGGRFGFKQSTEKGCNDPIRCYG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021760`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021760

Location Chr04:136460448-136461809 (+)

Description Similar to Peptide methionine sulfoxide reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25130`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	Differential regulation of plastidial and cytosolic isoforms of peptide methionine sulfoxide reductase in Arabidopsis.2000 · DOI: 10.1104/pp.123.1.255 A peptide methionine sulfoxide reductase highly expressed in photosynthetic tissue in Arabidopsis thaliana can protect the chaperone-like activity of a chloroplast-localized small heat shock protein.2002 · DOI: 10.1046/j.1365-313x.2002.029005545.x
`At5g61640`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	No verified direct reference in this release
`At5g07470`	Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021760 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0008113 peptide-methionine (S)-S-oxide reductase activity Molecular Function

GO:0033744 L-methionine (S)-S-oxide reductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G25130

ath:AT5G07470

ath:AT5G61640

bna:106346565

bna:106442570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.926

Rank 1 · LXL04_021760 · OH-1004

Mitochondrion0.119

Rank 2 · LXL04_021760 · OH-1004

Cytoplasm0.026

Rank 3 · LXL04_021760 · OH-1004

Nucleus0.020

Rank 4 · LXL04_021760 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_021760 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01625.29PMSR96-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021760	`PF01625.29`	PMSR	96	240	4.3e-58	196.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P54150`	Arabidopsis thaliana	Peptide methionine sulfoxide reductase A4, chloroplastic	61.217%	Swiss-Prot	strong database homology
`Q9FKF7`	Arabidopsis thaliana	Peptide methionine sulfoxide reductase A1	74.510%	Swiss-Prot	strong database homology
`Q9LY14`	Arabidopsis thaliana	Peptide methionine sulfoxide reductase A3	74.510%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card