LXL04_021207 | RubberDandelionOmics

Gene overview

LXL04_021207

Reference: OH-1004 Chr: Chr04 Coordinates: 124573677-124577522 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1482 bp · LXL04_021207|LXL04_021207|OH1004|cDNA

ATGATCAAAATCAAGAACTGTTTTCGCGACATAACCAGACCCTGCCACTCCGACGGCAAAGGACAAGGTATAGAAGAATATCCCGAAAAGGTTGGTGCTCCTCAAGAACAGAAAATTTTCACAGTTCAAGCCCTAGTTTCCGCCACAAACAATTTCGAAAATAAGCTTGGTCAAGGAGGTTTTGGTCCTGTTTTCAAGGGGAAGTTGGATGATGGCAGGGAGATTGCTGTGAAAAAGCTCTCACAGACGTCAAAACAAGG...

CDS

Download CDS FASTA

1482 bp · LXL04_021207|LXL04_021207|OH1004|CDS

ATGATCAAAATCAAGAACTGTTTTCGCGACATAACCAGACCCTGCCACTCCGACGGCAAAGGACAAGGTATAGAAGAATATCCCGAAAAGGTTGGTGCTCCTCAAGAACAGAAAATTTTCACAGTTCAAGCCCTAGTTTCCGCCACAAACAATTTCGAAAATAAGCTTGGTCAAGGAGGTTTTGGTCCTGTTTTCAAGGGGAAGTTGGATGATGGCAGGGAGATTGCTGTGAAAAAGCTCTCACAGACGTCAAAACAAGG...

Protein

Download Protein FASTA

493 aa · LXL04_021207|LXL04_021207|OH1004|PROTEIN

MIKIKNCFRDITRPCHSDGKGQGIEEYPEKVGAPQEQKIFTVQALVSATNNFENKLGQGGFGPVFKGKLDDGREIAVKKLSQTSKQGKREFTNEAKLLACIQHKNVVSLLGYCAFPEKLLVYEYVANESLDKLLFSAKRDVLDWKRRYAIIVGVAQGLLYLHEDSHDRIIHRDIKASNILLDGKWRPKIADFGMARLYPEDKTHVNTRVAGTNGYLAPEYVMHGNLSVKADVYSFGVVVLELISGQKNSTFNLDPDCQNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021207`
TK1151 ID	TkA04G433870
OH-1004 ID	LXL04_021207
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 73.529 / OH-1004 15.213 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021207

Location Chr04:124573677-124577522 (-)

Description Similar to CRK10: Cysteine-rich receptor-like protein kinase 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70740`	Cysteine-rich receptor-like protein kinase 43.	No verified direct reference in this release
`At1g56140`	Probable LRR receptor-like serine/threonine-protein kinase At1g56140.	No verified direct reference in this release
`At4g23180`	Cysteine-rich receptor-like protein kinase 10.	No verified direct reference in this release
`At4g23200`	Putative cysteine-rich receptor-like protein kinase 12.	No verified direct reference in this release
`At4g11490`	Putative cysteine-rich receptor-like protein kinase 33.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021207 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0052542 defense response by callose deposition Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G56140

ath:AT1G70740

ath:AT4G11490

ath:AT4G23180

ath:AT4G23200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.718

Rank 1 · LXL04_021207 · OH-1004

Cytoplasm0.207

Rank 2 · LXL04_021207 · OH-1004

Nucleus0.181

Rank 3 · LXL04_021207 · OH-1004

Endoplasmic reticulum0.044

Rank 4 · LXL04_021207 · OH-1004

Golgi apparatus0.028

Rank 5 · LXL04_021207 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr52-316 aa

PF00069.32Pkinase52-315 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021207	`PF07714.24`	PK_Tyr_Ser-Thr	52	316	6.3e-47	160.8
LXL04_021207	`PF00069.32`	Pkinase	52	315	9.8e-46	157.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAC3`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 43	58.612%	Swiss-Prot	strong database homology
`C0LGH3`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g56140	52.568%	Swiss-Prot	moderate database homology
`Q8GYA4`	Arabidopsis thaliana	Cysteine-rich receptor-like protein kinase 10	52.881%	Swiss-Prot	moderate database homology
`O65472`	Arabidopsis thaliana	Putative cysteine-rich receptor-like protein kinase 12	49.367%	Swiss-Prot	moderate database homology
`Q9LDN1`	Arabidopsis thaliana	Putative cysteine-rich receptor-like protein kinase 33	50.316%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card