Gene Card
Gene overview
cDNA / CDS / Protein Sequences
309 bp · TkA04G433870|TK1151|cDNA
ATGCTTATTATTCTTTTTTTTGGAACCGGCGGAGTTAAGTTAGTGCTGGGAGGGTCAGTTAAGACCGCGATGGCGCCCCCAGCCGTCACCACCACTTTGGTCACTCCGAAGAGCAACCCACCGATCCTTAGGAACCCCCGGACAACTGGGGTAAACCCGGATGCATCACCCCAGGATTCGAACCTGAGACCTCCACTAGGGAAGCCCAGGACGATAGCCAAACGACCTGGAGATCACTTGCTACATGCTTATTATTCAAT...
309 bp · TkA04G433870|TK1151|CDS
ATGCTTATTATTCTTTTTTTTGGAACCGGCGGAGTTAAGTTAGTGCTGGGAGGGTCAGTTAAGACCGCGATGGCGCCCCCAGCCGTCACCACCACTTTGGTCACTCCGAAGAGCAACCCACCGATCCTTAGGAACCCCCGGACAACTGGGGTAAACCCGGATGCATCACCCCAGGATTCGAACCTGAGACCTCCACTAGGGAAGCCCAGGACGATAGCCAAACGACCTGGAGATCACTTGCTACATGCTTATTATTCAAT...
Protein
Download Protein FASTA102 aa · TkA04G433870|TK1151|PROTEIN
MLIILFFGTGGVKLVLGGSVKTAMAPPAVTTTLVTPKSNPPILRNPRTTGVNPDASPQDSNLRPPLGKPRTIAKRPGDHLLHAYYSIDAMLYPFWIMSLMKP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA04G433870 |
|---|---|
| TK1151 ID | TkA04G433870 |
| OH-1004 ID | LXL04_021207 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 73.529 / OH-1004 15.213Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA04G433870 |
|---|---|
| Location | Chr04:109393718-109394026 (+) |
| Description | Similar to CRK10: Cysteine-rich receptor-like protein kinase 10 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0007165 signal transduction Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009751 response to salicylic acid Biological Process GO:0042742 defense response to bacterium Biological Process GO:0045088 regulation of innate immune response Biological Process GO:0052542 defense response by callose deposition Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component |
| KEGG gene cross-reference | ath:AT1G56140 ath:AT1G70740 ath:AT4G11490 ath:AT4G23180 ath:AT4G23200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.