LXL04_019733 | RubberDandelionOmics

Gene overview

LXL04_019733

Reference: OH-1004 Chr: Chr04 Coordinates: 38846244-38848347 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1734 bp · LXL04_019733|LXL04_019733|OH1004|cDNA

ATGGGCGATACTGAGGAAGGAAACAGCGATATGATCCAAAGAGTACAATCTTCCTCCGGGACTTCATCATCATCGGTTCCtaaacaacaacaaccacaaaaGCCTGTTAATTTTAATCAACTCGATATACCTCAGTTGAACACAGCACAGTTTCGCGGCCAAACACGACAGTTTTCCCCAAATTACAACCTCGATAATAACAGCAAAAGAGTCGGAATCCCGCCGTCTCACCCACAGTTTCCTCCGGTATCCCCTTACTC...

CDS

Download CDS FASTA

1734 bp · LXL04_019733|LXL04_019733|OH1004|CDS

ATGGGCGATACTGAGGAAGGAAACAGCGATATGATCCAAAGAGTACAATCTTCCTCCGGGACTTCATCATCATCGGTTCCTAAACAACAACAACCACAAAAGCCTGTTAATTTTAATCAACTCGATATACCTCAGTTGAACACAGCACAGTTTCGCGGCCAAACACGACAGTTTTCCCCAAATTACAACCTCGATAATAACAGCAAAAGAGTCGGAATCCCGCCGTCTCACCCACAGTTTCCTCCGGTATCCCCTTACTC...

Protein

Download Protein FASTA

577 aa · LXL04_019733|LXL04_019733|OH1004|PROTEIN

MGDTEEGNSDMIQRVQSSSGTSSSSVPKQQQPQKPVNFNQLDIPQLNTAQFRGQTRQFSPNYNLDNNSKRVGIPPSHPQFPPVSPYSQIPVTQSSGNTHKIGGSQSFNHTNHSPGPSHSRSLSQPSFFPLDSLPPLSPSPYRDSPSARSSDQVITDVPMEDRDTNSHSLLPPSSPSGRSNSGNFSRTENLPPRKAHRRSNSDIPFGFSTILQSSPPLIPLRTPNTLDRVTSSNNQSSKPIQLVKRESSWEKTGGEGNAEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019733`
TK1151 ID	TkA05G081960
OH-1004 ID	LXL04_019733
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019733

Location Chr04:38846244-38848347 (-)

Description Similar to POSF21: Probable transcription factor PosF21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g38900`	Transcription factor that acts as a repressor of reproductive development, meristem size and plant growth.	Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens.2016 · DOI: 10.1111/ppl.12439 Functional characterization of the Arabidopsis transcription factor bZIP29 reveals its role in leaf and root development.2016 · DOI: 10.1093/jxb/erw347
`At2g21230`	Transcription factor that acts as a repressor of reproductive development, meristem size and plant growth.	Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.2016 · DOI: 10.1111/tpj.13264
`At2g31370`	Putative transcription factor with an activatory role.	No verified direct reference in this release
`At2g40620`	Transcription factor that may participate with bZIP34 in the gametophytic control of pollen development.	Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.2017 · DOI: 10.1007/s00497-016-0295-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0336200`	Transcription factor probably involved in vascular development and shoot tissue organization.	RF2b, a rice bZIP transcription activator, interacts with RF2a and is involved in symptom development of rice tungro disease.2004 · DOI: 10.1073/pnas.0307687100

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019733 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0090567 reproductive shoot system development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0048471 perinuclear region of cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G21230

ath:AT2G31370

ath:AT2G40620

ath:AT4G38900

dosa:Os03g0336200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.964

Rank 1 · LXL04_019733 · OH-1004

Cytoplasm0.132

Rank 2 · LXL04_019733 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_019733 · OH-1004

Endoplasmic reticulum0.011

Rank 4 · LXL04_019733 · OH-1004

Plastid0.009

Rank 5 · LXL04_019733 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07716.21bZIP_2421-473 aa

PF00170.27bZIP_1424-482 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019733	`PF07716.21`	bZIP_2	421	473	7.5e-08	33.0
LXL04_019733	`PF00170.27`	bZIP_1	424	482	1.2e-09	38.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1F0`	Arabidopsis thaliana	bZIP transcription factor 29	57.876%	Swiss-Prot	strong database homology
`Q9SIG8`	Arabidopsis thaliana	bZIP transcription factor 30	53.700%	Swiss-Prot	strong database homology
`Q04088`	Arabidopsis thaliana	Probable transcription factor PosF21	38.071%	Swiss-Prot	moderate database homology
`O22873`	Arabidopsis thaliana	bZIP transcription factor 18	60.123%	Swiss-Prot	weak database homology
`Q6S4P4`	Oryza sativa subsp. japonica	Transcription factor RF2b	63.514%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card