RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G081960
Reference: TK1151 Chr: Chr05 Coordinates: 22193716-22196644 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2417 bp · TkA05G081960|TK1151|cDNA

GATGTGTAACAAAGAGATTCATTGCTCCATGATCTGCGGTGATGGAGGGAGAAATTGTTTTTTGGATAGCCTACTAGTCAAACATCGGTCGGAATGAAATTGAAATTCGTCCCAAACTCACATTCAATTTCCTATCAAAACCCTTATTAAATTCACGCGTAAATCACTACCATCTACAAGTAGTAGCAGTCATGAAATCCGTGTACAAGTCATCGTCATTGATATATACAACTTACAATTATTAACTTTAGTGTGAGAAA...

CDS

Download CDS FASTA

1728 bp · TkA05G081960|TK1151|CDS

ATGGGCGATACTGAGGAAGGAAACAGCGATATGATCCAAAGAGTACAATCTTCCTTCGGGACTTCATCATCATCGGTTCCTAAACAACAACCACCACAAAAGCCTGTTAATTTTAATCAACTCGATATACCTCAGTTGAACACAGCACAGTTTCGCGGCCAAACACGACAGTTTTCCCCAAATTACAACCTCGATAATAACAGTAAAAGAGTCGGAATCCCGCCATCTCACCCACAGTTTCCTCCGGTATCCCCTTACTC...

Protein

Download Protein FASTA

575 aa · TkA05G081960|TK1151|PROTEIN

MGDTEEGNSDMIQRVQSSFGTSSSSVPKQQPPQKPVNFNQLDIPQLNTAQFRGQTRQFSPNYNLDNNSKRVGIPPSHPQFPPVSPYSQIPVTQSSGNTHKIGGSQSFNHTNQSPGPSHSRSLSQPSFFPLDSLPPLSPSPYRDSPSARSSDQVITDVPMEDRDTNSHSLLPPSSPSGRSNSGNFSRTENLPPRKAHRRSNSDIPFGFSTILQSSPPLIPLRTPNTLDRVTSSNNQSSKPIQLVKRESSWEKTGGEGNAEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G081960
TK1151 IDTkA05G081960
OH-1004 IDLXL04_019733
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.100
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G081960
LocationChr05:22193716-22196644 (-)
DescriptionSimilar to POSF21: Probable transcription factor PosF21
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g38900 Transcription factor that acts as a repressor of reproductive development, meristem size and plant growth.
Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens.2016 · DOI: 10.1111/ppl.12439
Functional characterization of the Arabidopsis transcription factor bZIP29 reveals its role in leaf and root development.2016 · DOI: 10.1093/jxb/erw347
At2g21230 Transcription factor that acts as a repressor of reproductive development, meristem size and plant growth.
Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana.2016 · DOI: 10.1111/tpj.13264
At2g31370 Putative transcription factor with an activatory role. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0336200 Transcription factor probably involved in vascular development and shoot tissue organization.
RF2b, a rice bZIP transcription activator, interacts with RF2a and is involved in symptom development of rice tungro disease.2004 · DOI: 10.1073/pnas.0307687100
Os09g0516200 Transcription factor probably involved in vascular development and shoot tissue organization.
Transcription factor RF2a alters expression of the rice tungro bacilliform virus promoter in transgenic tobacco plants.2001 · DOI: 10.1073/pnas.121186398
Functional analysis of RF2a, a rice transcription factor.2003 · DOI: 10.1074/jbc.m304862200
RF2b, a rice bZIP transcription activator, interacts with RF2a and is involved in symptom development of rice tungro disease.2004 · DOI: 10.1073/pnas.0307687100
RF2a, a bZIP transcriptional activator of the phloem-specific rice tungro bacilliform virus promoter, functions in vascular development.1997 · DOI: 10.1093/emboj/16.17.5247
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_019733 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0010628 positive regulation of gene expression Biological Process
GO:0010629 negative regulation of gene expression Biological Process
GO:0090567 reproductive shoot system development Biological Process
GO:0005634 nucleus Cellular Component
GO:0005654 nucleoplasm Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0048471 perinuclear region of cytoplasm Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference
ath:AT2G21230
ath:AT2G31370
ath:AT2G40620
ath:AT4G38900
dosa:Os03g0336200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963
Rank 1 · TkA05G081960 · TK1151
Cytoplasm0.132
Rank 2 · TkA05G081960 · TK1151
Cell membrane0.023
Rank 3 · TkA05G081960 · TK1151
Endoplasmic reticulum0.011
Rank 4 · TkA05G081960 · TK1151
Plastid0.009
Rank 5 · TkA05G081960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28159CEP89248-549 aa
PF06005ZapB279-289 aa
PF03131bZIP_Maf405-485 aa
PF26095CC_Bre1420-495 aa
PF07716bZIP_2421-473 aa
PF00170bZIP_1424-482 aa
PF14662KASH_CCD431-521 aa
PF19579FtsL_2440-475 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G081960PF28159CEP892485490.01814.3
TkA05G081960PF06005ZapB2792891.89.8
TkA05G081960PF03131bZIP_Maf4054850.01117.0
TkA05G081960PF26095CC_Bre14204950.2812.2
TkA05G081960PF07716bZIP_24214737.5e-0833.0
TkA05G081960PF00170bZIP_14244821.1e-0938.9
TkA05G081960PF14662KASH_CCD4315210.009316.7
TkA05G081960PF19579FtsL_24404750.2512.0
TkA05G081960PF26666DUF82214414861.49.8
TkA05G081960PF06156YabA4464978.47.8
TkA05G081960PF07334IFP_35_N4474730.07113.9
TkA05G081960PF04102SlyX4474986.78.2
TkA05G081960PF06005ZapB4485071.89.8
TkA05G081960PF16559GIT_CC4514860.1612.4
TkA05G081960PF25014NET2A4525240.002118.7
TkA05G081960PF07889DUF16644575301.39.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8H1F0Arabidopsis thalianasp|Q8H1F0|BZP29_ARATH bZIP transcription factor 2958.200%Swiss-ProtHigh
Q9SIG8Arabidopsis thalianasp|Q9SIG8|BZP30_ARATH bZIP transcription factor 3051.500%Swiss-ProtHigh
Q04088Arabidopsis thalianasp|Q04088|POF21_ARATH Probable transcription factor PosF2143.700%Swiss-ProtLow
Q6S4P4Oryza sativa subsp. japonicasp|Q6S4P4|RF2B_ORYSJ Transcription factor RF2b71.800%Swiss-ProtLow
Q69IL4Oryza sativa subsp. japonicasp|Q69IL4|RF2A_ORYSJ Transcription factor RF2a70.200%Swiss-ProtLow

JBrowse

View in Genome Browser