LXL04_019631 | RubberDandelionOmics

Gene overview

LXL04_019631

Reference: OH-1004 Chr: Chr04 Coordinates: 35585043-35587061 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · LXL04_019631|LXL04_019631|OH1004|cDNA

ATGGATTTGAAGGTGAAGGTAGGAGGTGTAAAAGATGGGGATATGTCAGAACCGGTGAGCCCTACCGGGCAGTACTTCAACAGCTCGGTGCTTTCTGTTTCTCTTATTTGCATTTTGGAGTTTGACAACCCCATTGATGACTCTTCAAGCCTTTCACTAATCAACGATGTCTTTCTGCCCATTAGTGCTCGTTTCTCTTCCATTATGGTTAAAGACAAAGATGGAGTGAAGCGCTGGAAGAGAGTAGAAGTAAACGGGAA...

CDS

Download CDS FASTA

798 bp · LXL04_019631|LXL04_019631|OH1004|CDS

ATGGATTTGAAGGTGAAGGTAGGAGGTGTAAAAGATGGGGATATGTCAGAACCGGTGAGCCCTACCGGGCAGTACTTCAACAGCTCGGTGCTTTCTGTTTCTCTTATTTGCATTTTGGAGTTTGACAACCCCATTGATGACTCTTCAAGCCTTTCACTAATCAACGATGTCTTTCTGCCCATTAGTGCTCGTTTCTCTTCCATTATGGTTAAAGACAAAGATGGAGTGAAGCGCTGGAAGAGAGTAGAAGTAAACGGGAA...

Protein

Download Protein FASTA

265 aa · LXL04_019631|LXL04_019631|OH1004|PROTEIN

MDLKVKVGGVKDGDMSEPVSPTGQYFNSSVLSVSLICILEFDNPIDDSSSLSLINDVFLPISARFSSIMVKDKDGVKRWKRVEVNGKDHIKVPCFPEGLSPESYDHYFNDYLSNIAMDPLPQTKPLWEIHVIKYPTTNASGNLVFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPHFQKHVTPENKVKSLIGVVPQVLSGALNSVMDFGWSVLQSSFLKDRESPICSGKERVEFRPISIMTMKFSLDEIKRIKSCLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_019631`
TK1151 ID	TkA05G069750
OH-1004 ID	LXL04_019631
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 92.982 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_019631

Location Chr04:35585043-35587061 (+)

Description Similar to WSD1: O-acyltransferase WSD1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49190`	Bifunctional wax ester synthase/diacylglycerol acyltransferase (By similarity).	No verified direct reference in this release
`At5g53390`	Bifunctional wax ester synthase/diacylglycerol acyltransferase (By similarity).	Physical interaction of floral organs controls petal morphogenesis in Arabidopsis.2013 · DOI: 10.1104/pp.112.212084 The Half-Size ABC Transporter FOLDED PETALS 2/ABCG13 Is Involved in Petal Elongation through Narrow Spaces in Arabidopsis thaliana Floral Buds.2014 · DOI: 10.3390/plants3030348
`At5g12420`	Bifunctional wax ester synthase/diacylglycerol acyltransferase that uses acyl-CoAs with 14, 16 and 18 carbons as substrates, preferably in combination with 16:0ol alcohol.	Surface wax esters contribute to drought tolerance in Arabidopsis.2019 · DOI: 10.1111/tpj.14269
`At3g49210`	Bifunctional wax ester synthase/diacylglycerol acyltransferase that uses acyl-CoAs with 16, 18 and 20 carbons as substrates, preferably in combination with 16:0ol alcohol.	Surface wax esters contribute to drought tolerance in Arabidopsis.2019 · DOI: 10.1111/tpj.14269

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019631 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0048441 petal development Biological Process

GO:0048446 petal morphogenesis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ag:AAZ08051

ath:AT3G49190

ath:AT3G49210

ath:AT5G12420

ath:AT5G53390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.448

Rank 1 · LXL04_019631 · OH-1004

Cytoplasm0.193

Rank 2 · LXL04_019631 · OH-1004

Nucleus0.155

Rank 3 · LXL04_019631 · OH-1004

Lysosome / Vacuole0.154

Rank 4 · LXL04_019631 · OH-1004

Cell membrane0.128

Rank 5 · LXL04_019631 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03007.22WS_DGAT_cat108-261 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_019631	`PF03007.22`	WS_DGAT_cat	108	261	2e-09	38.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3B3`	Arabidopsis thaliana	Wax ester synthase/diacylglycerol acyltransferase 4	27.376%	Swiss-Prot	weak database homology
`Q5KS41`	Arabidopsis thaliana	Wax ester synthase/diacylglycerol acyltransferase 11	30.620%	Swiss-Prot	moderate database homology
`Q94CK0`	Arabidopsis thaliana	Wax ester synthase/diacylglycerol acyltransferase 7	28.458%	Swiss-Prot	weak database homology
`Q9M3B1`	Arabidopsis thaliana	Wax ester synthase/diacylglycerol acyltransferase 6	27.099%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card