TkA05G069750 | RubberDandelionOmics

Gene overview

TkA05G069750

Reference: TK1151 Chr: Chr05 Coordinates: 18683546-18689176 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1348 bp · TkA05G069750|TK1151|cDNA

AACATTAGTAAAGTATTTCGCAAAAGAAAAAAAAAAACACGGCGCTAGTTAGACTGAAATGGATTTGAAGGTGAAGGTAGGAGGTGTAAAAGATGGGGATATGTCAGAACCGGTGAGCCCTACCGGGCAGTACTTCAACAGCTCGGTGCTTTCTGTTTCTCTTATTTGCATTTTGGAGTTTGACAACCCCATTGATGACTCTTCAAGCCTTTCACTAATCAACGATGTCTTTCTGCCCATTAGTGCTCGTTTCTCTTCCA...

CDS

Download CDS FASTA

855 bp · TkA05G069750|TK1151|CDS

ATGGATTTGAAGGTGAAGGTAGGAGGTGTAAAAGATGGGGATATGTCAGAACCGGTGAGCCCTACCGGGCAGTACTTCAACAGCTCGGTGCTTTCTGTTTCTCTTATTTGCATTTTGGAGTTTGACAACCCCATTGATGACTCTTCAAGCCTTTCACTAATCAACGATGTCTTTCTGCCCATTAGTGCTCGTTTCTCTTCCATTATGGTTAAAGACAAAGATGGAGTGAAGCGCTGGAAGAGAGTAGAAGTAAACGGGAA...

Protein

Download Protein FASTA

285 aa · TkA05G069750|TK1151|PROTEIN

MDLKVKVGGVKDGDMSEPVSPTGQYFNSSVLSVSLICILEFDNPIDDSSSLSLINDVFLPISARFSSIMVKDKDGVKRWKRVEVNGKDHIKVPCFPEGLSPESYDHYFNDYLSNIAMDPLPQTKPLWEIHVIKYPTTNASGNLVFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPHFQKHVTPENKVKSLIGVVPQVLSGALNSVMDFGWSVLQSSFLKDRESPICSGKEGVEFRPISIMTMKFSLDEIKRIKSCLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G069750`
TK1151 ID	TkA05G069750
OH-1004 ID	LXL04_019631
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 92.982 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G069750`
Location	Chr05:18683546-18689176 (+)
Description	Similar to WSD1: O-acyltransferase WSD1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019631` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010025 wax biosynthetic process Biological Process GO:0019432 triglyceride biosynthetic process Biological Process GO:0048441 petal development Biological Process GO:0048446 petal morphogenesis Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component
KEGG gene cross-reference	ag:AAZ08051 ath:AT3G49190 ath:AT3G49210 ath:AT5G12420 ath:AT5G53390 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.439

Rank 1 · TkA05G069750 · TK1151

Cytoplasm0.217

Rank 2 · TkA05G069750 · TK1151

Nucleus0.188

Rank 3 · TkA05G069750 · TK1151

Lysosome / Vacuole0.123

Rank 4 · TkA05G069750 · TK1151

Cell membrane0.115

Rank 5 · TkA05G069750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07247AATase102-156 aa

PF03007WS_DGAT_cat108-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G069750	`PF07247`	AATase	102	156	0.05	12.9
TkA05G069750	`PF03007`	WS_DGAT_cat	108	256	9.1e-09	36.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card