Gene Card
Gene overview
cDNA / CDS / Protein Sequences
612 bp · LXL04_019485|LXL04_019485|OH1004|cDNA
ATGGTGGAACCCAATGTACCCGTCGATACTAGCACGATCAAGAAAATGACTAAAGGCAAGCAAAAGATTGTCATAAAGAAGATAGAAGAAACCAACAGGCGTCAAGACTTTACCGGAGCCCAAATCGCCATCCAGGTTACTTCCCCAGGTGGTGGTCAGGTCTATGCGTTTCCCCACTCCAACAACGACGTCCTGTTTGACAGCTCTCTTAATAATAACAACAAAGACGCCACCACCTCCAACAACACCGGAGCAGAGAC...
612 bp · LXL04_019485|LXL04_019485|OH1004|CDS
ATGGTGGAACCCAATGTACCCGTCGATACTAGCACGATCAAGAAAATGACTAAAGGCAAGCAAAAGATTGTCATAAAGAAGATAGAAGAAACCAACAGGCGTCAAGACTTTACCGGAGCCCAAATCGCCATCCAGGTTACTTCCCCAGGTGGTGGTCAGGTCTATGCGTTTCCCCACTCCAACAACGACGTCCTGTTTGACAGCTCTCTTAATAATAACAACAAAGACGCCACCACCTCCAACAACACCGGAGCAGAGAC...
Protein
Download Protein FASTA203 aa · LXL04_019485|LXL04_019485|OH1004|PROTEIN
MVEPNVPVDTSTIKKMTKGKQKIVIKKIEETNRRQDFTGAQIAIQVTSPGGGQVYAFPHSNNDVLFDSSLNNNNKDATTSNNTGAETGTTQNYQPPPAMKESNKHYTEVPRELEAEKKLKETIPVSRGGLRWYDEPVDGMDVEELELYLCSLEELKNKVLTRADELMMINSSKNNIIQPEDISTNTAVDGGLNFKHGDDFGNL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_019485 |
|---|---|
| TK1151 ID | TkA05G055780 |
| OH-1004 ID | LXL04_019485 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 79.100 |
| Protein coverage (%) | TK1151 99.383 / OH-1004 94.089Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_019485 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:32351100-32351711 (-) | |||||||||
| Description | Similar to AGL62: Agamous-like MADS-box protein AGL62 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009559 embryo sac central cell differentiation Biological Process GO:0009960 endosperm development Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:2000012 regulation of auxin polar transport Biological Process GO:0005634 nucleus Cellular Component GO:0043078 polar nucleus Cellular Component GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0046983 protein dimerization activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G24840 ath:AT5G60440 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.