Gene Card
Gene overview
cDNA / CDS / Protein Sequences
564 bp · LXL04_008131|LXL04_008131|OH1004|cDNA
ATGACCGGCAACGTGTTACCGGGTAATTTGGCGGAGCAGGAGGAGAGTTCAATTATGGAATCCCAAAAAAAGCAATCATCCGAATGGACGAATGTGAAGCACAGTTTATATCTGAAGTCAATTGAAGCATCATTCATTAACCAATTATACAACTCTCTAGATATGCAAAGCCGTCAAACACAAAAAACCTCTTCCAGCCAGTTCAAGGTTCTTCAGGGTGGCTGTTGGTCAAATAAAAAGTTGAGGGGAGAAAATGAAAA...
564 bp · LXL04_008131|LXL04_008131|OH1004|CDS
ATGACCGGCAACGTGTTACCGGGTAATTTGGCGGAGCAGGAGGAGAGTTCAATTATGGAATCCCAAAAAAAGCAATCATCCGAATGGACGAATGTGAAGCACAGTTTATATCTGAAGTCAATTGAAGCATCATTCATTAACCAATTATACAACTCTCTAGATATGCAAAGCCGTCAAACACAAAAAACCTCTTCCAGCCAGTTCAAGGTTCTTCAGGGTGGCTGTTGGTCAAATAAAAAGTTGAGGGGAGAAAATGAAAA...
Protein
Download Protein FASTA187 aa · LXL04_008131|LXL04_008131|OH1004|PROTEIN
MTGNVLPGNLAEQEESSIMESQKKQSSEWTNVKHSLYLKSIEASFINQLYNSLDMQSRQTQKTSSSQFKVLQGGCWSNKKLRGENENPQPKHSKRSNNNPWIRHFTKASPFLQERLLSDLACSNTEVTDQNFVEDLSMEKADRPNNRKRKTVANSSNDQLVRFVLIEICLSGGSFLPHISGKTLTQT
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_008131 |
|---|---|
| TK1151 ID | TkA05G366250 |
| OH-1004 ID | LXL04_008131 |
| Relationship / confidence | Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable |
| Protein identity (%) | 96.900 |
| Protein coverage (%) | TK1151 95.322 / OH-1004 87.166Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_008131 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:88603226-88604940 (+) | |||||||||
| Description | Similar to COR27: Cold-regulated protein 27 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0009409 response to cold Biological Process GO:0009615 response to virus Biological Process GO:0009637 response to blue light Biological Process GO:0009646 response to absence of light Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010114 response to red light Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0042752 regulation of circadian rhythm Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0048511 rhythmic process Biological Process GO:0048573 photoperiodism, flowering Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT4G33980 ath:AT5G42900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF30692.1COR2725-109 aaPF30692.1COR27118-161 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_008131 | PF30692.1 | COR27 | 25 | 109 | 5.2e-27 | 96.1 |
| LXL04_008131 | PF30692.1 | COR27 | 118 | 161 | 5.2e-27 | 96.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.