TkA05G366250 | RubberDandelionOmics

Gene overview

TkA05G366250

Reference: TK1151 Chr: Chr05 Coordinates: 90971340-90981295 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

828 bp · TkA05G366250|TK1151|cDNA

ATCAACAGAAAATATCTAAAATTCACAGCGATTTTTCTCTCGCACTTATTTCTTAAAATCTCTATGCAATATCTTCTTGTGATATCCTAGATAGAGGTTCTTCTCCGGCGACGACAACGACTACGACTACCGTTGTATTTCGTGTTGTAGATGACCGGCAACGTGTTACCGGGTAATTTGGCGGAGCAGGAGGAGAGTTCAATTATGGAATCCCAAAAAAAGCAATCATCCGAATGGACGAATGTGAAGCACAGTTTATA...

CDS

Download CDS FASTA

516 bp · TkA05G366250|TK1151|CDS

ATGACCGGCAACGTGTTACCGGGTAATTTGGCGGAGCAGGAGGAGAGTTCAATTATGGAATCCCAAAAAAAGCAATCATCCGAATGGACGAATGTGAAGCACAGTTTATATCTGAAGTCAATTGAAGCATCATTCATTAACCAATTATACAACTCTCTAGATATGCAAAGCCGTCAAACACAAAAAACCTCTTCCAGCCAGTTCAAGGTTCTTCAGGGTGGCTGTTGGTCAAATAAAAAGTTGAGGGGAGAAAATGAAAA...

Protein

Download Protein FASTA

171 aa · TkA05G366250|TK1151|PROTEIN

MTGNVLPGNLAEQEESSIMESQKKQSSEWTNVKHSLYLKSIEASFINQLYNSLDMQSRQTQKTSSSQFKVLQGGCWSNKKLRGENENPQQKHSKRSNNNPWIRHFTKASPFLQERLLSDLGCSNTEVTDQNFVEELSMEKADRPNNRKRKTVANSSNDQVVPFCRTSPARL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G366250`
TK1151 ID	TkA05G366250
OH-1004 ID	LXL04_008131
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	96.900
Protein coverage (%)	TK1151 95.322 / OH-1004 87.166 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G366250

Location Chr05:90971340-90981295 (-)

Description Similar to COR27: Cold-regulated protein 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42900`	Together with COR28, involved in central circadian clock regulation and in flowering promotion, by binding to the chromatin of clock-associated evening genes TOC1, PRR5, ELF4 and cold-responsive genes in order to repress their transcription.	Blue Light- and Low Temperature-Regulated COR27 and COR28 Play Roles in the Arabidopsis Circadian Clock.2016 · DOI: 10.1105/tpc.16.00354 COR27 and COR28 encode nighttime repressors integrating Arabidopsis circadian clock and cold response.2017 · DOI: 10.1111/jipb.12512

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008131 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009615 response to virus Biological Process

GO:0009637 response to blue light Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010114 response to red light Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048511 rhythmic process Biological Process

GO:0048573 photoperiodism, flowering Biological Process

KEGG gene cross-reference

ath:AT4G33980

ath:AT5G42900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.922

Rank 1 · TkA05G366250 · TK1151

Cytoplasm0.166

Rank 2 · TkA05G366250 · TK1151

Cell membrane0.041

Rank 3 · TkA05G366250 · TK1151

Endoplasmic reticulum0.022

Rank 4 · TkA05G366250 · TK1151

Mitochondrion0.012

Rank 5 · TkA05G366250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27202Flk_N22-42 aa

PF30692COR2725-109 aa

PF22521HypF_C_230-85 aa

PF27202Flk_N103-116 aa

PF30692COR27117-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G366250	`PF27202`	Flk_N	22	42	0.14	13.1
TkA05G366250	`PF30692`	COR27	25	109	1.1e-29	104.8
TkA05G366250	`PF22521`	HypF_C_2	30	85	0.1	13.1
TkA05G366250	`PF27202`	Flk_N	103	116	0.14	13.1
TkA05G366250	`PF30692`	COR27	117	163	1.1e-29	104.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L8T7`	Arabidopsis thaliana	sp\|Q8L8T7\|COR27_ARATH Cold-regulated protein 27	40.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card