LXL04_001581 | RubberDandelionOmics

Gene overview

LXL04_001581

Reference: OH-1004 Chr: Chr01 Coordinates: 29386886-29388025 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1140 bp · LXL04_001581|LXL04_001581|OH1004|cDNA

ATGACCACCATCTTTCTATTCCTCTACCTCCTCCTCATatccaccgccaccgccactgccaccACCCTCTATTCCGATGTCTCCGCCCTCAAAGCCATAAAGGCCGCCATCGATCCCACCACCATCCCTTCTTACTCTTGCTTAGCCTCCTGGAATTTCACCTCCGATCCTTGCTCCAACCATCACGTCACTCACTTCCTCTGTGGCCTCTCCTGCTCCGGCAACCGAGTCACCCAACTCACCTTCGATCGCGCAGGTTA...

CDS

Download CDS FASTA

1140 bp · LXL04_001581|LXL04_001581|OH1004|CDS

ATGACCACCATCTTTCTATTCCTCTACCTCCTCCTCATATCCACCGCCACCGCCACTGCCACCACCCTCTATTCCGATGTCTCCGCCCTCAAAGCCATAAAGGCCGCCATCGATCCCACCACCATCCCTTCTTACTCTTGCTTAGCCTCCTGGAATTTCACCTCCGATCCTTGCTCCAACCATCACGTCACTCACTTCCTCTGTGGCCTCTCCTGCTCCGGCAACCGAGTCACCCAACTCACCTTCGATCGCGCAGGTTA...

Protein

Download Protein FASTA

379 aa · LXL04_001581|LXL04_001581|OH1004|PROTEIN

MTTIFLFLYLLLISTATATATTLYSDVSALKAIKAAIDPTTIPSYSCLASWNFTSDPCSNHHVTHFLCGLSCSGNRVTQLTFDRAGYVGTLSPLVSKLTQLITIDISDNKLSGPIPASLFSLPNLQTLNLRSNSFSGTIPPAISNLKSIQAIEISHNSLSGSLPDTLSLLTLTRLDLSFNKFTGPIPKLPKTLIELAVKSNSLSGYLPKTSFNGLTQLEVVELSDNSLTGTIPGWFLLQQSLQQVNLANNGFTGIEISKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001581`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001581

Location Chr01:29386886-29388025 (-)

Description Similar to GSO1: LRR receptor-like serine/threonine-protein kinase GSO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At3g51740`	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0576900`	Functions in the early stages of organ development by regulating cell division rate.	XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassinosteroids and cell cycling in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04877.x
`Os01g0917500`	Receptor-like kinase that plays important roles in restricting the number of cells entering into male and female sporogenesis.	The MSP1 gene is necessary to restrict the number of cells entering into male and female sporogenesis and to initiate anther wall formation in rice.2003 · DOI: 10.1105/tpc.012401
`Os07g0568700`	Inhibitor of fungal polygalacturonase.	The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice.2003 · DOI: 10.1023/b:plan.0000006940.89955.f1

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001581 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0045184 establishment of protein localization Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:0160073 Casparian strip assembly Biological Process

GO:2000067 regulation of root morphogenesis Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0048226 Casparian strip Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G20140

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.368

Rank 1 · LXL04_001581 · OH-1004

Cell membrane0.328

Rank 2 · LXL04_001581 · OH-1004

Endoplasmic reticulum0.129

Rank 3 · LXL04_001581 · OH-1004

Cytoplasm0.074

Rank 4 · LXL04_001581 · OH-1004

Nucleus0.035

Rank 5 · LXL04_001581 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_897-134 aa

PF00560.40LRR_1124-146 aa

PF13855.13LRR_8193-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001581	`PF13855.13`	LRR_8	97	134	1.3e-22	80.0
LXL04_001581	`PF00560.40`	LRR_1	124	146	2e-26	87.0
LXL04_001581	`PF13855.13`	LRR_8	193	251	1.3e-22	80.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	35.357%	Swiss-Prot	moderate database homology
`Q9SCT4`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2	32.278%	Swiss-Prot	moderate database homology
`G9LZD7`	Oryza sativa subsp. japonica	Probable inactive leucine-rich repeat receptor kinase XIAO	34.106%	Swiss-Prot	moderate database homology
`Q8RZV7`	Oryza sativa subsp. japonica	Leucine-rich repeat receptor protein kinase MSP1	28.821%	Swiss-Prot	weak database homology
`Q8GT95`	Oryza sativa subsp. japonica	Polygalacturonase inhibitor 1	33.101%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card