TkAUNG098330 | RubberDandelionOmics

Gene overview

TkAUNG098330

Reference: TK1151 Chr: ChrUn Coordinates: 27771579-27773592 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1617 bp · TkAUNG098330|TK1151|cDNA

GTGAGTGTGGGCTGTGGGCATTCCGTTTGACAGACTCGTTACCTTAGAAACCTCTTTTTTCCCTCGCCCCATTCCTCACATACTACAAGCTCCCATGGAATTCTCGATAATCAATCATCACTTGCGTAAATTATCGATCCTGATGATACCTGGAAATGGAATCAGCTCATGAATGCAAACCTTCCACGCGTGTCTTAAAATTTCTCAGATTATTCATTGAAAGCGGAAAGGAATCCTTCTCAGAGCTACATAAACTCCTT...

CDS

Download CDS FASTA

1158 bp · TkAUNG098330|TK1151|CDS

ATGTATGGTAGATCAGGTCTTGACCGTTTCAAAAAGGCACAAACCCTAGAACCATTCTCAGTAGCAAAAAAACCACAATTACATTCCCATTCTGATATCCCCAATCACCAAAACACTCATCAACCTTCTCAAAAACCAACAAACAATGATCCAAAACACCTTCCAACAACCACCACAACCCCACACCACCTAACACAAACTGGAGCTGGACAGTCCACCTGGCAACCACCCGATTGGGCCATTGAACCCCGCCCAGGTGT...

Protein

Download Protein FASTA

385 aa · TkAUNG098330|TK1151|PROTEIN

MYGRSGLDRFKKAQTLEPFSVAKKPQLHSHSDIPNHQNTHQPSQKPTNNDPKHLPTTTTTPHHLTQTGAGQSTWQPPDWAIEPRPGVYYLDVLKDSELLDKINLDKRKHIFGRQLQTCDFVLDHPSVSRQHAAVVPHKNGSIFVIDLGSAHGTFVANERLQKDSPIELEIGQSLRFAASTRVYILKKDNSALFPHPPPSQITLPPPPNPLDEEAVLSYNTFINRYNLSKSQDSQETERPVKRAKRAKVSFRDQVGGELVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG098330`
TK1151 ID	TkAUNG098330
OH-1004 ID	LXL04_026957
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG098330

Location ChrUn:27771579-27773592 (-)

Description Similar to At5g47790: Protein phosphatase 1 regulatory inhibitor subunit PPP1R8 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g47790`	Inhibitor of protein-phosphatase 1 (PP1).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026957 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006401 RNA catabolic process Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005681 spliceosomal complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G47790

bta:282319

hsa:22950

hsa:5511

mmu:100336

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.819

Rank 1 · TkAUNG098330 · TK1151

Cytoplasm0.272

Rank 2 · TkAUNG098330 · TK1151

Cell membrane0.029

Rank 3 · TkAUNG098330 · TK1151

Mitochondrion0.028

Rank 4 · TkAUNG098330 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkAUNG098330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16697Yop-YscD_cpl102-172 aa

PF00498FHA110-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG098330	`PF16697`	Yop-YscD_cpl	102	172	1.5e-05	25.9
TkAUNG098330	`PF00498`	FHA	110	176	1.6e-18	67.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FIK2`	Arabidopsis thaliana	sp\|Q9FIK2\|PP1R8_ARATH Protein phosphatase 1 regulatory inhibitor subunit PPP1R8 homolog	55.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card