Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2003 bp · TkAUNG093700|TK1151|cDNA
TTACAGTCGCATAAACATTTAGACCCGTGGGATTACTGTCTCGTGCTTGAACCACATCCTTTTGTTCTTCTGAGTTCCGACCCTCAATTTCCCATTTGCTGCAAATTACCCAAAAATCGGCTTTACCCACCTCCTGATCTTTCAACAATCATCATACTACACCACCTACAAATGAGGAACGCAATGCAAATCAACCAACACTTGGTGTGCTTCTTCTAAGTTTGCCCACAATCAACAGCCGCAACAATGGCGACAGCTTT...
1503 bp · TkAUNG093700|TK1151|CDS
ATGGCGACAGCTTTCTCTCTCATCTCTTCATCCTCTCTCAACTTCATTCGAGACCCTCTACCGTCTCCTTCACCCTCCGCGTCATCCTCGTCCCCTTTCTTCGGAGGTGGAACACTCTCGTTCACCCGTAGCAGCAGCAGCAACAACAACAAGAGTTGCGTGTCCTTCTCGTCCTCTCCGCAATTCAACAAGAAGAGGTACCGCAAGCGCGGTGGAGGATTACTTGTGTTCGCGGCGGCGGATTATTACTCTACTCTTGG...
Protein
Download Protein FASTA500 aa · TkAUNG093700|TK1151|PROTEIN
MATAFSLISSSSLNFIRDPLPSPSPSASSSSPFFGGGTLSFTRSSSSNNNKSCVSFSSSPQFNKKRYRKRGGGLLVFAAADYYSTLGVPKSATVKDIKAAYRKLARQYHPDVNKQPGATEKFKEISNAYEVLSDDKKRAMYDRYGEDGVKSTVGGQSGAYATNPFDLFETFFGTSMGGFAGGDTTGFGGGGRRPTVIKGEDIRYDMTLEFSSAIFGTEKEFELSHLETCDVCTGTGAKVGSKMRICSTCGGRGQVMRTEQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG093700 |
|---|---|
| TK1151 ID | TkAUNG093700 |
| OH-1004 ID | LXL04_001990 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG093700 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | ChrUn:26514875-26518169 (+) | ||||||||||||
| Description | Similar to dnaJ: Chaperone protein DnaJ (Thermosynechococcus elongatus (strain BP-1) | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006260 DNA replication Biological Process GO:0006457 protein folding Biological Process GO:0009408 response to heat Biological Process GO:0042026 protein refolding Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0009507 chloroplast Cellular Component GO:0005524 ATP binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0031072 heat shock protein binding Molecular Function GO:0051082 unfolded protein binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | amr:AM1_0423 dosa:Os05g0333500 dosa:Os05g0334400 osa:107275576 osa:4338449 osa:4338452 tel:tll0790 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00226DnaJ81-142 aaPF30912TIM141_C85-113 aaPF27659CHP0264292-113 aaPF01556DnaJ_C202-420 aaPF30758Orange_C216-260 aaPF15777Anti-TRAP226-259 aaPF27659CHP02642227-261 aaPF17302DUF5351227-237 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG093700 | PF00226 | DnaJ | 81 | 142 | 1.3e-27 | 96.3 |
| TkAUNG093700 | PF30912 | TIM141_C | 85 | 113 | 0.074 | 13.8 |
| TkAUNG093700 | PF27659 | CHP02642 | 92 | 113 | 0.0035 | 17.6 |
| TkAUNG093700 | PF01556 | DnaJ_C | 202 | 420 | 2.1e-40 | 139.0 |
| TkAUNG093700 | PF30758 | Orange_C | 216 | 260 | 4.1 | 8.6 |
| TkAUNG093700 | PF15777 | Anti-TRAP | 226 | 259 | 0.00016 | 22.3 |
| TkAUNG093700 | PF27659 | CHP02642 | 227 | 261 | 0.0035 | 17.6 |
| TkAUNG093700 | PF17302 | DUF5351 | 227 | 237 | 0.014 | 16.4 |
| TkAUNG093700 | PF20833 | RNase_E_G_Thio | 228 | 237 | 1.3 | 9.9 |
| TkAUNG093700 | PF18912 | DZR_2 | 228 | 251 | 6.9 | 7.3 |
| TkAUNG093700 | PF00684 | DnaJ_CXXCXGXG | 229 | 293 | 1.6e-15 | 57.8 |
| TkAUNG093700 | PF30758 | Orange_C | 229 | 291 | 4.1 | 8.6 |
| TkAUNG093700 | PF12773 | DZR | 236 | 289 | 0.33 | 11.8 |
| TkAUNG093700 | PF23733 | GRXCR1-2_C | 244 | 286 | 1.0 | 10.0 |
| TkAUNG093700 | PF20833 | RNase_E_G_Thio | 245 | 261 | 1.3 | 9.9 |
| TkAUNG093700 | PF17302 | DUF5351 | 246 | 254 | 0.014 | 16.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.