LXL04_001990 | RubberDandelionOmics

Gene overview

LXL04_001990

Reference: OH-1004 Chr: Chr01 Coordinates: 38536148-38538971 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1503 bp · LXL04_001990|LXL04_001990|OH1004|cDNA

ATGGCGACAGCTTTCTCTCTCATCTCTTCATCCTCTCTCAACTTCATTCGAGACCCTCTACCGTCTCCTTCACCCTCCGCGTCATCCTCGTCCCCTTTCTTCGGAGGTGGAACACTCTCGTTCACCCGTAGcagcagcagcaacaacaacaagaGTTGCGTGTCCTTCTCGTCCTCTCCGCAATTCAACAAGAAGAGGTACCGCAAGCGCGGTGGAGGATTACTTGTGTTCGCGGCGGCGGATTATTATTCTACTCTTGG...

CDS

Download CDS FASTA

1503 bp · LXL04_001990|LXL04_001990|OH1004|CDS

ATGGCGACAGCTTTCTCTCTCATCTCTTCATCCTCTCTCAACTTCATTCGAGACCCTCTACCGTCTCCTTCACCCTCCGCGTCATCCTCGTCCCCTTTCTTCGGAGGTGGAACACTCTCGTTCACCCGTAGCAGCAGCAGCAACAACAACAAGAGTTGCGTGTCCTTCTCGTCCTCTCCGCAATTCAACAAGAAGAGGTACCGCAAGCGCGGTGGAGGATTACTTGTGTTCGCGGCGGCGGATTATTATTCTACTCTTGG...

Protein

Download Protein FASTA

500 aa · LXL04_001990|LXL04_001990|OH1004|PROTEIN

MATAFSLISSSSLNFIRDPLPSPSPSASSSSPFFGGGTLSFTRSSSSNNNKSCVSFSSSPQFNKKRYRKRGGGLLVFAAADYYSTLGVPKSATVKDIKAAYRKLARQYHPDVNKQPGATEKFKEISNAYEVLSDDKKRAMYDRYGEDGVKSTVGGQSGAYATNPFDLFETFFGTSMGGFAGSDTTGFGGGGRRPTVIKGEDIRYDMTLEFSSAIFGTEKEFELSHLETCDVCTGTGAKVGSKMRICSTCGGRGQVMRTEQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001990`
TK1151 ID	TkAUNG093700
OH-1004 ID	LXL04_001990
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001990

Location Chr01:38536148-38538971 (-)

Description Similar to dnaJ: Chaperone protein DnaJ (Thermosynechococcus elongatus (strain BP-1)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0334400`	Plays pivotal roles in chloroplast development.	No verified direct reference in this release
`Os05g0334000`	Plays pivotal roles in chloroplast development.	No verified direct reference in this release
`Os05g0333500`	Plays pivotal roles in chloroplast development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001990 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006457 protein folding Biological Process

GO:0009408 response to heat Biological Process

GO:0042026 protein refolding Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0031072 heat shock protein binding Molecular Function

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

amr:AM1_0423

dosa:Os05g0333500

dosa:Os05g0334400

osa:107275576

osa:4338449

osa:4338452

tel:tll0790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.967

Rank 1 · LXL04_001990 · OH-1004

Mitochondrion0.042

Rank 2 · LXL04_001990 · OH-1004

Cytoplasm0.024

Rank 3 · LXL04_001990 · OH-1004

Nucleus0.020

Rank 4 · LXL04_001990 · OH-1004

Peroxisome0.017

Rank 5 · LXL04_001990 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00226.37DnaJ81-142 aa

PF01556.24DnaJ_C202-420 aa

PF00684.26DnaJ_CXXCXGXG229-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001990	`PF00226.37`	DnaJ	81	142	1.3e-27	96.3
LXL04_001990	`PF01556.24`	DnaJ_C	202	420	3.2e-40	138.4
LXL04_001990	`PF00684.26`	DnaJ_CXXCXGXG	229	293	1.6e-15	57.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DO03`	Oryza sativa subsp. japonica	Chaperone protein dnaJ A8, chloroplastic	53.083%	Swiss-Prot	strong database homology
`P0DO02`	Oryza sativa subsp. japonica	Chaperone protein dnaJ A7B, chloroplastic	53.083%	Swiss-Prot	strong database homology
`P0DO01`	Oryza sativa subsp. japonica	Chaperone protein dnaJ A7A, chloroplastic	53.083%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card