TkAUNG090120 | RubberDandelionOmics

Gene overview

TkAUNG090120

Reference: TK1151 Chr: ChrUn Coordinates: 25583594-25585112 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · TkAUNG090120|TK1151|cDNA

ATGACTCTAGAAGAGGATAGACTAAGCAGCTTGCCAGATGAACTTATCTACAAAATCCTCTCTCATCTTAGCCTCCAAGAGGCTATAGAGACAAGTGTTTTGTCAACTAGCTGGAGGTCTATCTGGAAGTCAATGCCCTATCTCAATTTTGTAAGTTTGGTCAAGATCGATAGTCCGCACGACTTCTTCACATTAGTTTATAATGTTTTGTCTCATCGCAATAATCAAGCACAATTGTCTTCAGTCGATTTGTATTGTGA...

CDS

Download CDS FASTA

1131 bp · TkAUNG090120|TK1151|CDS

ATGACTCTAGAAGAGGATAGACTAAGCAGCTTGCCAGATGAACTTATCTACAAAATCCTCTCTCATCTTAGCCTCCAAGAGGCTATAGAGACAAGTGTTTTGTCAACTAGCTGGAGGTCTATCTGGAAGTCAATGCCCTATCTCAATTTTGTAAGTTTGGTCAAGATCGATAGTCCGCACGACTTCTTCACATTAGTTTATAATGTTTTGTCTCATCGCAATAATCAAGCACAATTGTCTTCAGTCGATTTGTATTGTGA...

Protein

Download Protein FASTA

376 aa · TkAUNG090120|TK1151|PROTEIN

MTLEEDRLSSLPDELIYKILSHLSLQEAIETSVLSTSWRSIWKSMPYLNFVSLVKIDSPHDFFTLVYNVLSHRNNQAQLSSVDLYCDGKVSHEFVKRFLEYMVTHNIQQLNLTWLLEDEAEFPLSLYSCRSLQHLNLHDIAFRASYSATPTWDLPNLTTLHLSNITVSNNCSDLFSKSCPNLKNLKLNGFTMRNTNVFEICHPQLSNLTLEWTCWGVEVVNVVAPQLKNLTIKHGYRKHLICAHGLTSLVIEGIDHLQQI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG090120`
TK1151 ID	TkAUNG090120
OH-1004 ID	LXL04_026023
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.800
Protein coverage (%)	TK1151 99.734 / OH-1004 61.983 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG090120

Location ChrUn:25583594-25585112 (-)

Description Similar to At2g05300: Putative F-box/FBD/LRR-repeat protein At2g05300

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g03220`	Putative F-box/FBD/LRR-repeat protein At4g03220.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At1g78730`	Putative FBD-associated F-box protein At1g78730.	No verified direct reference in this release
`At5g54820`	Putative F-box/LRR-repeat protein At5g54820.	No verified direct reference in this release
`At3g58900`	F-box/LRR-repeat protein At3g58900.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026023 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT4G03220

ath:AT5G22720

ath:AT5G53840

ath:AT5G56560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.778

Rank 1 · TkAUNG090120 · TK1151

Cytoplasm0.255

Rank 2 · TkAUNG090120 · TK1151

Cell membrane0.049

Rank 3 · TkAUNG090120 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkAUNG090120 · TK1151

Plastid0.019

Rank 5 · TkAUNG090120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box8-46 aa

PF12937F-box-like8-41 aa

PF23622LRR_At1g61320_AtMIF178-298 aa

PF24758LRR_At5g5637096-236 aa

PF12799LRR_4126-138 aa

PF00646F-box132-140 aa

PF12799LRR_4155-190 aa

PF00646F-box175-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG090120	`PF00646`	F-box	8	46	1.6e-09	37.9
TkAUNG090120	`PF12937`	F-box-like	8	41	0.00014	22.2
TkAUNG090120	`PF23622`	LRR_At1g61320_AtMIF1	78	298	4.3e-12	46.8
TkAUNG090120	`PF24758`	LRR_At5g56370	96	236	3.8e-12	47.1
TkAUNG090120	`PF12799`	LRR_4	126	138	0.024	15.6
TkAUNG090120	`PF00646`	F-box	132	140	1.6e-09	37.9
TkAUNG090120	`PF12799`	LRR_4	155	190	0.024	15.6
TkAUNG090120	`PF00646`	F-box	175	184	1.6e-09	37.9
TkAUNG090120	`PF12799`	LRR_4	239	259	0.024	15.6
TkAUNG090120	`PF23952`	LRR_EndoS	239	273	0.029	15.3
TkAUNG090120	`PF12799`	LRR_4	296	310	0.024	15.6
TkAUNG090120	`PF23952`	LRR_EndoS	345	360	0.029	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZR09`	Arabidopsis thaliana	sp\|Q9ZR09\|FDL25_ARATH Putative F-box/FBD/LRR-repeat protein At4g03220	26.900%	Swiss-Prot	Low
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	28.600%	Swiss-Prot	Low
`Q9ZV91`	Arabidopsis thaliana	sp\|Q9ZV91\|FBD35_ARATH Putative FBD-associated F-box protein At1g78730	24.100%	Swiss-Prot	Low
`Q9FFU7`	Arabidopsis thaliana	sp\|Q9FFU7\|FBL90_ARATH Putative F-box/LRR-repeat protein At5g54820	24.400%	Swiss-Prot	Low
`Q93ZX6`	Arabidopsis thaliana	sp\|Q93ZX6\|FBL57_ARATH F-box/LRR-repeat protein At3g58900	27.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card