TkAUNG090050 | RubberDandelionOmics

Gene overview

TkAUNG090050

Reference: TK1151 Chr: ChrUn Coordinates: 25570249-25573025 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1234 bp · TkAUNG090050|TK1151|cDNA

CACACATTACGCTTTTGTTGAAAGTAATTGTATTTGGGAAGCAACAATTTGCCATATTGAAATGAAAGTGTAGATTTTTCGGCGTAAATGATCATATCGGTACGGATATACATACACCCGTAGGCGCCTATACGAAAAATCATTTTCCAGATATAACGAATTCCCCGTTGTCGAAGCGATTCATTTCCAGCTATAATCTATTGAACACGAAGAACAAATAACCGTTCAACAATGGATGTCGATCCGAGACAGTACGAGAA...

CDS

Download CDS FASTA

648 bp · TkAUNG090050|TK1151|CDS

ATGGATGTCGATCCGAGACAGTACGAGAACATTAAAATAAACGACAATGACAGCCACAATATCATCTTATCATATCTCATACACGGATGCTACAAAGACACAGTGGAATCACTAGTTGCTTCTACTGGATTAAAAGTACCCCCTCCTCAAATCGAGAATATGGAAAAAAGAAAACGAATTTTACACTCTGCGTTAAAGGGCAATGCATTGGATGCTATTTCTTTAACAGAACAAGTCTCACCTGACCTACTTGAAAACAA...

Protein

Download Protein FASTA

215 aa · TkAUNG090050|TK1151|PROTEIN

MDVDPRQYENIKINDNDSHNIILSYLIHGCYKDTVESLVASTGLKVPPPQIENMEKRKRILHSALKGNALDAISLTEQVSPDLLENNKDLLFDLLSLHFVKLICSKKITEAVEFARAKLTPFGMVPKYVHKLEEFMALLAYEEPEKSPMFHLLSIEYRQHVAESLNRAILAYGKLPSYSELERLIQQATVVTQCLSEELGKDVQSGFSLKDFVKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG090050`
TK1151 ID	TkAUNG090050
OH-1004 ID	LXL04_037082
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	29.300
Protein coverage (%)	TK1151 83.721 / OH-1004 75.934 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG090050`
Location	ChrUn:25570249-25573025 (+)
Description	Similar to GID8: Protein GID8 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037082` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008284 positive regulation of cell population proliferation Biological Process GO:0016055 Wnt signaling pathway Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0048263 determination of dorsal identity Biological Process GO:0090263 positive regulation of canonical Wnt signaling pathway Biological Process GO:0000151 ubiquitin ligase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0030054 cell junction Cellular Component GO:0030674 protein-macromolecule adaptor activity Molecular Function
KEGG gene cross-reference	ath:AT1G61150 ddi:DDB_G0279265 dre:566067 gga:419235 nve:5502962 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.679

Rank 1 · TkAUNG090050 · TK1151

Nucleus0.380

Rank 2 · TkAUNG090050 · TK1151

Cell membrane0.079

Rank 3 · TkAUNG090050 · TK1151

Lysosome / Vacuole0.065

Rank 4 · TkAUNG090050 · TK1151

Mitochondrion0.063

Rank 5 · TkAUNG090050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14893PNMA_C50-83 aa

PF10607CTLH54-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG090050	`PF14893`	PNMA_C	50	83	0.14	12.3
TkAUNG090050	`PF10607`	CTLH	54	192	3e-33	115.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card