LXL04_037082 | RubberDandelionOmics

Gene overview

LXL04_037082

Reference: OH-1004 Chr: Chr08 Coordinates: 52837039-52838664 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

755 bp · LXL04_037082|LXL04_037082|OH1004|cDNA

TTATCCGTCAACTAGCAGAAATCGAAGCCATGGCTACTTCAAAGAAGGTAATAACAAGAGACGAATGGGAGAAAAAGCTTAACGATGTTAAAATTCGAAAAGAAGACATGAACAAATTGGTGATGAATTTTCTTGTCACTGAGGGATATGTTGATGCAGCAGAAAAGTTCCGTATGGAATCTGGCACAGAACCAGATATAGATCTTGCAACAATTACAGACCGCATGGCTGTTAAAAAAGCAGTCCAGTCAGGAAACGTT...

CDS

Download CDS FASTA

726 bp · LXL04_037082|LXL04_037082|OH1004|CDS

ATGGCTACTTCAAAGAAGGTAATAACAAGAGACGAATGGGAGAAAAAGCTTAACGATGTTAAAATTCGAAAAGAAGACATGAACAAATTGGTGATGAATTTTCTTGTCACTGAGGGATATGTTGATGCAGCAGAAAAGTTCCGTATGGAATCTGGCACAGAACCAGATATAGATCTTGCAACAATTACAGACCGCATGGCTGTTAAAAAAGCAGTCCAGTCAGGAAACGTTGAAGATGCAATCGAAAAAGTCAATGATTT...

Protein

Download Protein FASTA

241 aa · LXL04_037082|LXL04_037082|OH1004|PROTEIN

MATSKKVITRDEWEKKLNDVKIRKEDMNKLVMNFLVTEGYVDAAEKFRMESGTEPDIDLATITDRMAVKKAVQSGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKVEEALEFAQEELAPRGEENQSFLEELERTVALLAFEDVKNSPVSDLLDISQRLKTASEVNAAILTSQSHEKNPKLPSLLRMLYGHKISLMKRQLIHELPIFSQPHLKTLLFDLVKHWLTFKFDVLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037082`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037082

Location Chr08:52837039-52838664 (+)

Description Similar to GID8: Protein GID8 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61150`	Protein GID8 homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037082 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0048263 determination of dorsal identity Biological Process

GO:0090263 positive regulation of canonical Wnt signaling pathway Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0030054 cell junction Cellular Component

GO:0030674 protein-macromolecule adaptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G61150

ddi:DDB_G0279265

dre:566067

gga:419235

nve:5502962

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.532

Rank 1 · LXL04_037082 · OH-1004

Nucleus0.448

Rank 2 · LXL04_037082 · OH-1004

Golgi apparatus0.086

Rank 3 · LXL04_037082 · OH-1004

Mitochondrion0.082

Rank 4 · LXL04_037082 · OH-1004

Cell membrane0.082

Rank 5 · LXL04_037082 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08513.18LisH25-51 aa

PF10607.15CTLH62-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037082	`PF08513.18`	LisH	25	51	2.9e-09	37.3
LXL04_037082	`PF10607.15`	CTLH	62	196	1.8e-36	126.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WK5`	Arabidopsis thaliana	Protein GID8 homolog	83.333%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card