TkAUNG087800 | RubberDandelionOmics

Gene overview

TkAUNG087800

Reference: TK1151 Chr: ChrUn Coordinates: 24936275-24939228 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1668 bp · TkAUNG087800|TK1151|cDNA

GTACCAAAATGTTTTTTTTTTTATCCGATCGTTTTGCATAAAATACCGGCAAGAATGGCAACAAGATTCTTACCAACCCCAAAGGGAAAAAGGCATGTGAGTTGTCACCAACCAGAAAGCCCACCATAACTCGATTGGGCTACACTGCGTTGACGAGAGATTTCACATTGAAGATTGAATTTGAATCTGTTAACCCTATTCTCAAAAATGGCAAAAAAATATCTTACCTCTAGTATTTCTCTCTCTTTCTTGGGAGCTGT...

CDS

Download CDS FASTA

963 bp · TkAUNG087800|TK1151|CDS

ATGGAACACCAAAATTCAGTACCCTCAGTTACCACAACGACGACGGAACCATCTTACGCGACTATGGCGGTGGATCCTTTCTTGGTTGAGGCTCTTCAGAACCCTCGTCATCGTCTCTCCATTCTTCGAATGGAACTCGACATTCAGAAGTTCATTCAGAACTCGGAACAGACCCAATTCGAATTCCAACATTTTCCCACTTCCTATCTCCGCCTTGCAGCCCACCGTGTAGCCCAACACTACACCCTCCAAACCATGGT...

Protein

Download Protein FASTA

320 aa · TkAUNG087800|TK1151|PROTEIN

MEHQNSVPSVTTTTTEPSYATMAVDPFLVEALQNPRHRLSILRMELDIQKFIQNSEQTQFEFQHFPTSYLRLAAHRVAQHYTLQTMVLDNYSDTQGTRILVKKLPETKYPSVILSDIPTKLSEHEKQDVKIVLKPRPKSSFDGTNGEGKKCNMVRSVEERKEEYDRARARIFSTPGSPQSDGSTPDGDEGEGSRSFGFDGNTSRVAILRDREKDLTDPDYDRSYDRYVRNLPVGQGFNMLPPGVQYDAVIPHMGPTLPLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG087800`
TK1151 ID	TkAUNG087800
OH-1004 ID	LXL04_000205
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG087800`
Location	ChrUn:24936275-24939228 (+)
Description	Similar to R3HDM1: R3H domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000205` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0010467 gene expression Biological Process GO:0019722 calcium-mediated signaling Biological Process GO:0030154 cell differentiation Biological Process GO:0034605 cellular response to heat Biological Process GO:0050852 T cell receptor signaling pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003730 mRNA 3'-UTR binding Molecular Function GO:0005516 calmodulin binding Molecular Function
KEGG gene cross-reference	bta:613499 hsa:10777 hsa:23518 mmu:71750 mmu:74100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.646

Rank 1 · TkAUNG087800 · TK1151

Nucleus0.385

Rank 2 · TkAUNG087800 · TK1151

Cell membrane0.071

Rank 3 · TkAUNG087800 · TK1151

Lysosome / Vacuole0.053

Rank 4 · TkAUNG087800 · TK1151

Golgi apparatus0.050

Rank 5 · TkAUNG087800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23218PH_AIR914-42 aa

PF01424R3H41-87 aa

PF23218PH_AIR9120-149 aa

PF12752SUZ129-174 aa

PF12752SUZ177-189 aa

PF07351DUF1480197-228 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG087800	`PF23218`	PH_AIR9	14	42	0.22	12.7
TkAUNG087800	`PF01424`	R3H	41	87	2.5e-08	34.5
TkAUNG087800	`PF23218`	PH_AIR9	120	149	0.22	12.7
TkAUNG087800	`PF12752`	SUZ	129	174	1.1e-10	42.7
TkAUNG087800	`PF12752`	SUZ	177	189	1.1e-10	42.7
TkAUNG087800	`PF07351`	DUF1480	197	228	0.17	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card