LXL04_000205 | RubberDandelionOmics

Gene overview

LXL04_000205

Reference: OH-1004 Chr: Chr01 Coordinates: 4059624-4061925 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · LXL04_000205|LXL04_000205|OH1004|cDNA

ATGGAACACCAAAATTCAGTACCCTCAGTTACCACAACGACGACGGAACCATCTTACGCGACTATGGCGGTGGATCCTTTCTTGGTTGAGGCTCTTCAGAACCCTCGTCATCGTCTCTCCATTCTTCGTATGGAACTGGACATTCAGAAGTTCATTCAGAACTCCGAACAGACCCAATTTGAATTCCAACATTTTCCCACTTCCTATCTCCGCCTTGCAGCCCACCGTGTAGCCCAACACTACACCCTCCAAACCATGGT...

CDS

Download CDS FASTA

963 bp · LXL04_000205|LXL04_000205|OH1004|CDS

ATGGAACACCAAAATTCAGTACCCTCAGTTACCACAACGACGACGGAACCATCTTACGCGACTATGGCGGTGGATCCTTTCTTGGTTGAGGCTCTTCAGAACCCTCGTCATCGTCTCTCCATTCTTCGTATGGAACTGGACATTCAGAAGTTCATTCAGAACTCCGAACAGACCCAATTTGAATTCCAACATTTTCCCACTTCCTATCTCCGCCTTGCAGCCCACCGTGTAGCCCAACACTACACCCTCCAAACCATGGT...

Protein

Download Protein FASTA

320 aa · LXL04_000205|LXL04_000205|OH1004|PROTEIN

MEHQNSVPSVTTTTTEPSYATMAVDPFLVEALQNPRHRLSILRMELDIQKFIQNSEQTQFEFQHFPTSYLRLAAHRVAQHYTLQTMVLDNYSDTQGTRILVKKLPETKYPSVILSDIPTKLSEHEKQDVKIVLKPRPKSSFDGTNGKGKKCNMVRSVEERKEEYDRARARIFSTPGSPQSDGSTPDGDEGEGSRSFSFDGNTSRVAILRDREKDLTDPDYDRSYDRYVRNLPVGQGFNMLPPGVQYDAVIPHMGPTLPLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000205`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_000205`
Location	Chr01:4059624-4061925 (+)
Description	Similar to R3HDM1: R3H domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000205` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0010467 gene expression Biological Process GO:0019722 calcium-mediated signaling Biological Process GO:0030154 cell differentiation Biological Process GO:0034605 cellular response to heat Biological Process GO:0050852 T cell receptor signaling pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0003676 nucleic acid binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003730 mRNA 3'-UTR binding Molecular Function GO:0005516 calmodulin binding Molecular Function
KEGG gene cross-reference	bta:613499 hsa:10777 hsa:23518 mmu:71750 mmu:74100 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.657

Rank 1 · LXL04_000205 · OH-1004

Nucleus0.374

Rank 2 · LXL04_000205 · OH-1004

Cell membrane0.073

Rank 3 · LXL04_000205 · OH-1004

Lysosome / Vacuole0.052

Rank 4 · LXL04_000205 · OH-1004

Golgi apparatus0.048

Rank 5 · LXL04_000205 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01424.29R3H41-87 aa

PF12752.13SUZ129-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000205	`PF01424.29`	R3H	41	87	2.7e-08	34.4
LXL04_000205	`PF12752.13`	SUZ	129	174	6e-11	43.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card