TkAUNG083890 | RubberDandelionOmics

Gene overview

TkAUNG083890

Reference: TK1151 Chr: ChrUn Coordinates: 23847827-23849802 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1264 bp · TkAUNG083890|TK1151|cDNA

TTTGAAAACGGCTGGCCGGTGGTATTTCGCGTATGTTGAAAATCAGAGCGTTTGAAAAAATTTACACCCACAAGAGTTTCGGAATATTGTGGTACGCCATTTTCCAAAACGAAATTACAAGATATTTGTTCAAGATTTTGTTATTTAGCTGATCCTACTGTTATCCTTTAAAATGCCAACGGTGAAACGCACACCACCTGTTTGTGAAAATGGCCACAACAAGTGCTCCGATTTTCCAGTCATGGGCACAAATCGTATCA...

CDS

Download CDS FASTA

858 bp · TkAUNG083890|TK1151|CDS

ATGGCCACAACAAGTGCTCCGATTTTCCAGTCATGGGCACAAATCGTATCAGCTTCTCGTGCTTCATCCAGTAGTAGCTTAACTCCTTTCGTCGCCAACACTCACGGTAGTAAAAAATTCACCGGTTATCCCTTACAAGAACATTACAGACGGAGGAATCCGTCGAAGACCAGCCGGAACATAAGGGCTGCCGCCGTCGTAGCAACGCCTCCAGCTGAGGAAGTGAAAGAAGCAGTTCTTCCCTCATGGGCGGAATTCGA...

Protein

Download Protein FASTA

285 aa · TkAUNG083890|TK1151|PROTEIN

MATTSAPIFQSWAQIVSASRASSSSSLTPFVANTHGSKKFTGYPLQEHYRRRNPSKTSRNIRAAAVVATPPAEEVKEAVLPSWAEFDIGRAPIFWKTMNGLPPSSGERLKLFYNPAASKLAPNKEFGIAFNGGFNQPIMCGGEPRAMLRKDRGKADPPYYTIQICVPKHAVNLIFSFTNGSEWDGPYKLQFQVPKAWQNRELDFFNQGLTEELSQEGACEKAIYPDTSIVIDRCQLMGNLTSVGADRCELDLVTGCLDPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG083890`
TK1151 ID	TkAUNG083890
OH-1004 ID	LXL04_032066
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG083890

Location ChrUn:23847827-23849802 (+)

Description Similar to PIFI: Protein POST-ILLUMINATION CHLOROPHYLL FLUORESCENCE INCREASE, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15840`	Required during nonphotochemical quenching.	A novel nucleus-encoded chloroplast protein, PIFI, is involved in NAD(P)H dehydrogenase complex-mediated chlororespiratory electron transport in Arabidopsis.2007 · DOI: 10.1104/pp.107.103218

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032066 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010196 nonphotochemical quenching Biological Process

GO:0010478 chlororespiration Biological Process

GO:0070370 cellular heat acclimation Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

KEGG gene cross-reference

ath:AT3G15840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.977

Rank 1 · TkAUNG083890 · TK1151

Nucleus0.026

Rank 2 · TkAUNG083890 · TK1151

Mitochondrion0.023

Rank 3 · TkAUNG083890 · TK1151

Cytoplasm0.019

Rank 4 · TkAUNG083890 · TK1151

Cell membrane0.017

Rank 5 · TkAUNG083890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25419Ig_PIFI84-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG083890	`PF25419`	Ig_PIFI	84	213	4e-71	238.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVZ5`	Arabidopsis thaliana	sp\|Q9LVZ5\|PIFI_ARATH Protein POST-ILLUMINATION CHLOROPHYLL FLUORESCENCE INCREASE, chloroplastic	68.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card