TkAUNG070510 | RubberDandelionOmics

Gene overview

TkAUNG070510

Reference: TK1151 Chr: ChrUn Coordinates: 20434490-20442441 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1399 bp · TkAUNG070510|TK1151|cDNA

TTTGGTGCGACTGTACTACCGACAAAACAAAATAAGCGATCTTATACATGCTAATATAAAAGATGAAATGAATCTCAAGTCACTGAACACGTTTATTACAATAGCTTATCGTTGTCTGGAGAGAGATTTGGAAGACCGTCCGTTGATGTCTGATGTCGTGCACATACTTGAAAGTGCGCTCGAATATCAAATGCTAATATCTCGGTTTATTTTTCTGAACTTTCAAACTTAGCATGGTGCTGGTTCAGGATTGATCATCA...

CDS

Download CDS FASTA

1185 bp · TkAUNG070510|TK1151|CDS

ATGAATCTCAAGTCACTGAACACGTTTATTACAATAGCTTATCGTTGTCTGGAGAGAGATTTGGAAGACCGTCCGTTGATGTCTGATGTCGTGCACATACTTGAAAGTGCGCTCGAATATCAACATGGTGCTGGTTCAGGATTGATCATCAGTAAGCAACCTGATAGCCATTCAACCAGTTCTGATAATGACAATTGGTTTAAACGAATATGGGCAAAGTTTGGGCTTGATTCAGCTGATTCAATACCAAAGGGGAAGCA...

Protein

Download Protein FASTA

394 aa · TkAUNG070510|TK1151|PROTEIN

MNLKSLNTFITIAYRCLERDLEDRPLMSDVVHILESALEYQHGAGSGLIISKQPDSHSTSSDNDNWFKRIWAKFGLDSADSIPKGKQAVPLEPILVPPIQVDELKKITNNFGSTSLIGEGTYGRTYFGVLRNGQTVAIKMLNSKKQSNQDFLAQVSKASIHRHVNLVELLGYCVDGDLRVLAYEFASVGSLHDILHGRERVRGVQSGPILSWPQRVKIVVGAAKGLEYLHDMARHRIIHHNIKSKNVLVFEDYVAKFADF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG070510`
TK1151 ID	TkAUNG070510
OH-1004 ID	LXL04_017665
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.600
Protein coverage (%)	TK1151 100.000 / OH-1004 59.756 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG070510

Location ChrUn:20434490-20442441 (+)

Description Similar to PTI1: Pto-interacting protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62220`	May phosphorylate ABA receptors and participate in ABA signaling during dehydration.	Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At3g17410`	May phosphorylate ABA receptors and participate in ABA signaling during dehydration.	CARK1 mediates ABA signaling by phosphorylation of ABA receptors.2018 · DOI: 10.1038/s41421-018-0029-y The Expression of CARK1 or RCAR11 Driven by Synthetic Promoters Increases Drought Tolerance in Arabidopsis thaliana .2018 · DOI: 10.3390/ijms19071945 Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At2g47060`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses (Probable).	The Arabidopsis protein kinase Pto-interacting 1-4 is a common target of the oxidative signal-inducible 1 and mitogen-activated protein kinases.2011 · DOI: 10.1111/j.1742-4658.2011.08033.x Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At1g48210`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors (e.g. PYR1/RCAR11, PYL1/RCAR12, PYL3/RCAR13 and PYL2/RCAR14) to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses.	No verified direct reference in this release
`At1g63970`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that converts 4-diphosphocytidyl-2C-methyl-D-erythritol 2- phosphate into 2C-methyl-D-erythritol 2,4-cyclodiphosphate and CMP.	Functional evidence for the involvement of Arabidopsis IspF homolog in the nonmevalonate pathway of plastid isoprenoid biosynthesis.2006 · DOI: 10.1007/s00425-005-0140-9

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0680600`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that converts 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate into 2C-methyl-D-erythritol 2,4-cyclodiphosphate and CMP (Probable).	A single nucleotide mutation of IspF gene involved in the MEP pathway for isoprenoid biosynthesis causes yellow-green leaf phenotype in rice.2018 · DOI: 10.1007/s11103-017-0668-7

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017665 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G48210

ath:AT3G17410

sly:544006

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.660

Rank 1 · TkAUNG070510 · TK1151

Cytoplasm0.257

Rank 2 · TkAUNG070510 · TK1151

Nucleus0.208

Rank 3 · TkAUNG070510 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkAUNG070510 · TK1151

Golgi apparatus0.034

Rank 5 · TkAUNG070510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase9-31 aa

PF07714PK_Tyr_Ser-Thr10-33 aa

PF00069Pkinase114-384 aa

PF07714PK_Tyr_Ser-Thr116-387 aa

PF24476DUF7580209-357 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG070510	`PF00069`	Pkinase	9	31	3.1e-34	119.3
TkAUNG070510	`PF07714`	PK_Tyr_Ser-Thr	10	33	1e-44	153.5
TkAUNG070510	`PF00069`	Pkinase	114	384	3.1e-34	119.3
TkAUNG070510	`PF07714`	PK_Tyr_Ser-Thr	116	387	1e-44	153.5
TkAUNG070510	`PF24476`	DUF7580	209	357	0.13	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1Q2`	Arabidopsis thaliana	sp\|Q9M1Q2\|CARK2_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 2	65.300%	Swiss-Prot	High
`Q9LUT0`	Arabidopsis thaliana	sp\|Q9LUT0\|CARK1_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 1	66.100%	Swiss-Prot	High
`O80719`	Arabidopsis thaliana	sp\|O80719\|CARK3_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 3	65.500%	Swiss-Prot	High
`F4HWU0`	Arabidopsis thaliana	sp\|F4HWU0\|CAK11_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 11	63.900%	Swiss-Prot	High
`Q9CAK8`	Arabidopsis thaliana	sp\|Q9CAK8\|ISPF_ARATH 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic	87.800%	Swiss-Prot	High
`Q6EPN6`	Oryza sativa subsp. japonica	sp\|Q6EPN6\|ISPF_ORYSJ 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplastic	82.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card