Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1599 bp · TkAUNG066240|TK1151|cDNA
ATGGGAAAGCACAGGAGATCAATGGTGGTTTGCTTCTCCAATAGATTGGGCAGCTGCAAATGGGCATTACGATCTAGTGAAACAGCTTCTCCAAATCGACCCCATCTCCTCATCAAACTCACCTCTCTTCCCCGCATCCGCCGCCTCGAAACGGTCTGGGACGACCACCTAAACGACGTCGCAGAATGCAGGTCCAAAGTCGCCCAAAAGCTCCTCCGCGAATGCGAATCGGAGAAAGGGCACTACTCTCTGATCAGAGC...
1599 bp · TkAUNG066240|TK1151|CDS
ATGGGAAAGCACAGGAGATCAATGGTGGTTTGCTTCTCCAATAGATTGGGCAGCTGCAAATGGGCATTACGATCTAGTGAAACAGCTTCTCCAAATCGACCCCATCTCCTCATCAAACTCACCTCTCTTCCCCGCATCCGCCGCCTCGAAACGGTCTGGGACGACCACCTAAACGACGTCGCAGAATGCAGGTCCAAAGTCGCCCAAAAGCTCCTCCGCGAATGCGAATCGGAGAAAGGGCACTACTCTCTGATCAGAGC...
Protein
Download Protein FASTA532 aa · TkAUNG066240|TK1151|PROTEIN
MGKHRRSMVVCFSNRLGSCKWALRSSETASPNRPHLLIKLTSLPRIRRLETVWDDHLNDVAECRSKVAQKLLRECESEKGHYSLIRAGYGGWLLYTAASAGDTIFVKELLSRDPLMVFGEGEYGITDIFYAAARSKSAEVFKAVLDASLALKEPQKEVFRWEMKNRAVHAAARGGAAAVLSELLGNGSDVLTFRDAQGSTLLHTAAGRGQVQVVKNLISSYNDIINSMDDRGNTALNVAAFRGHLPVFKLLLSASPSSAS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG066240 |
|---|---|
| TK1151 ID | TkAUNG066240 |
| OH-1004 ID | LXL04_020684 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 51.600 |
| Protein coverage (%) | TK1151 92.857 / OH-1004 79.233Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG066240 |
|---|---|
| Location | ChrUn:19262292-19264916 (-) |
| Description | Similar to Mib1: E3 ubiquitin-protein ligase MIB1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0006897 endocytosis Biological Process GO:0007219 Notch signaling pathway Biological Process GO:0010803 regulation of tumor necrosis factor-mediated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0045807 positive regulation of endocytosis Biological Process GO:0000139 Golgi membrane Cellular Component GO:0000151 ubiquitin ligase complex Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005769 early endosome Cellular Component GO:0005813 centrosome Cellular Component GO:0005829 cytosol Cellular Component |
| KEGG gene cross-reference | hsa:142678 hsa:57534 mmu:225164 mmu:76580 xla:444232 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12796Ank_267-146 aaPF13606Ank_390-111 aaPF00023Ank94-111 aaPF13857Ank_594-110 aaPF13637Ank_494-107 aaPF24521Ank_KRIT197-112 aaPF13606Ank_3129-146 aaPF12796Ank_2131-224 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG066240 | PF12796 | Ank_2 | 67 | 146 | 1.2e-37 | 129.1 |
| TkAUNG066240 | PF13606 | Ank_3 | 90 | 111 | 9e-16 | 56.9 |
| TkAUNG066240 | PF00023 | Ank | 94 | 111 | 3e-23 | 81.3 |
| TkAUNG066240 | PF13857 | Ank_5 | 94 | 110 | 5.7e-21 | 75.1 |
| TkAUNG066240 | PF13637 | Ank_4 | 94 | 107 | 1.3e-20 | 73.7 |
| TkAUNG066240 | PF24521 | Ank_KRIT1 | 97 | 112 | 1.6e-05 | 25.4 |
| TkAUNG066240 | PF13606 | Ank_3 | 129 | 146 | 9e-16 | 56.9 |
| TkAUNG066240 | PF12796 | Ank_2 | 131 | 224 | 1.2e-37 | 129.1 |
| TkAUNG066240 | PF00023 | Ank | 131 | 145 | 3e-23 | 81.3 |
| TkAUNG066240 | PF24521 | Ank_KRIT1 | 164 | 240 | 1.6e-05 | 25.4 |
| TkAUNG066240 | PF13857 | Ank_5 | 166 | 191 | 5.7e-21 | 75.1 |
| TkAUNG066240 | PF21834 | DUF6894 | 166 | 203 | 0.09 | 13.6 |
| TkAUNG066240 | PF00023 | Ank | 167 | 190 | 3e-23 | 81.3 |
| TkAUNG066240 | PF13606 | Ank_3 | 167 | 190 | 9e-16 | 56.9 |
| TkAUNG066240 | PF12796 | Ank_2 | 169 | 253 | 1.2e-37 | 129.1 |
| TkAUNG066240 | PF13637 | Ank_4 | 169 | 217 | 1.3e-20 | 73.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.