TkAUNG066160 | RubberDandelionOmics

Gene overview

TkAUNG066160

Reference: TK1151 Chr: ChrUn Coordinates: 19247305-19250612 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · TkAUNG066160|TK1151|cDNA

ATGGCTGCTACCTCCGCCTCTGGATCCGCCGCCGTCGCCTTCAAGTCTGCTGGCGTTTCTCACAAGAAAATCGCCAATTTCCGGGATGCGAAAGTATCGTCGCTGGCGAAGCTTCCGGGGCTCAGTTTGCAATGCCGGTCCATCAGATCCTTCTCCTCCTTAGGCATAAGGGCTCAGGTTGCAAGCATTGAACAAGTTAAAGATGAAGAAGCAAAGAAAATGGAAGCTCCTGTTGTGGTTATTACTGGAGCATCCAGAGG...

CDS

Download CDS FASTA

963 bp · TkAUNG066160|TK1151|CDS

ATGGCTGCTACCTCCGCCTCTGGATCCGCCGCCGTCGCCTTCAAGTCTGCTGGCGTTTCTCACAAGAAAATCGCCAATTTCCGGGATGCGAAAGTATCGTCGCTGGCGAAGCTTCCGGGGCTCAGTTTGCAATGCCGGTCCATCAGATCCTTCTCCTCCTTAGGCATAAGGGCTCAGGTTGCAAGCATTGAACAAGTTAAAGATGAAGAAGCAAAGAAAATGGAAGCTCCTGTTGTGGTTATTACTGGAGCATCCAGAGG...

Protein

Download Protein FASTA

320 aa · TkAUNG066160|TK1151|PROTEIN

MAATSASGSAAVAFKSAGVSHKKIANFRDAKVSSLAKLPGLSLQCRSIRSFSSLGIRAQVASIEQVKDEEAKKMEAPVVVITGASRGIGKAIALALGKSGCKVLVNYARSSKEAEEVCEQIEASGGQALTFGGDVSKEADVNSMIKTAVDAWGTIDVMINNAGGITRDNLLMRMKTSQWQEVIDLNLTGVFLCTQAAAKIMMRKKKGRIINIASVVGLVGNVGQANYSAAKAGVIGFTKTVAKEYSSRNITVNAVAPGFI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG066160`
TK1151 ID	TkAUNG066160
OH-1004 ID	LXL04_025644
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	77.300
Protein coverage (%)	TK1151 99.062 / OH-1004 21.482 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG066160

Location ChrUn:19247305-19250612 (+)

Description Similar to CLKR27: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24360`	3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025644 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

bna:106367337

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.971

Rank 1 · TkAUNG066160 · TK1151

Mitochondrion0.041

Rank 2 · TkAUNG066160 · TK1151

Nucleus0.016

Rank 3 · TkAUNG066160 · TK1151

Cytoplasm0.013

Rank 4 · TkAUNG066160 · TK1151

Cell membrane0.008

Rank 5 · TkAUNG066160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14520HHH_511-42 aa

PF12242Eno-Rase_NADH_b55-101 aa

PF14520HHH_557-72 aa

PF02882THF_DHG_CYH_C68-120 aa

PF00106adh_short78-271 aa

PF08659KR79-237 aa

PF01370Epimerase79-150 aa

PF13561adh_short_C283-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG066160	`PF14520`	HHH_5	11	42	0.046	14.9
TkAUNG066160	`PF12242`	Eno-Rase_NADH_b	55	101	0.024	15.1
TkAUNG066160	`PF14520`	HHH_5	57	72	0.046	14.9
TkAUNG066160	`PF02882`	THF_DHG_CYH_C	68	120	0.011	15.9
TkAUNG066160	`PF00106`	adh_short	78	271	3.3e-64	216.7
TkAUNG066160	`PF08659`	KR	79	237	1.4e-19	71.4
TkAUNG066160	`PF01370`	Epimerase	79	150	0.061	13.4
TkAUNG066160	`PF13561`	adh_short_C2	83	318	3.6e-63	214.0
TkAUNG066160	`PF14520`	HHH_5	87	102	0.046	14.9
TkAUNG066160	`PF02882`	THF_DHG_CYH_C	203	265	0.011	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P33207`	Arabidopsis thaliana	sp\|P33207\|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic	72.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card