LXL04_025644 | RubberDandelionOmics

Gene overview

LXL04_025644

Reference: OH-1004 Chr: Chr05 Coordinates: 114661468-114671566 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4600 bp · LXL04_025644|LXL04_025644|OH1004|cDNA

ACACTCCAACGCTTCCAACTTCGACTATATCGCCATCGTCGGAGCTTCCAAGACAAAAAAAACCTTCCATCACCAATATCTATAAACCGAGGCCTTATTTCTTCCTTCAAATTCATTTGTGGCGACCCCTACAATAGCTTCGCTTCGCTTCTCTTTCTCTTCACTTACTGTATTCCCATCACTCATGGCTGCGTCTGCTTCTTTCGCCGGATCGGCTGTCGCCGCTTTCAAATCCACTGGAATCTCAGAGAAGTCTGCCC...

CDS

Download CDS FASTA

4416 bp · LXL04_025644|LXL04_025644|OH1004|CDS

ATGGCTGCGTCTGCTTCTTTCGCCGGATCGGCTGTCGCCGCTTTCAAATCCACTGGAATCTCAGAGAAGTCTGCCCTCGGGAGAGTCTCCTTTTTCCGCAACAATGCTTCGTCACTTCAGCTCCAGCGGAGCTTCAATTATTCGCAATGCCGATCTAAGATGTCATTCGCTTCATCAGGTGTAAAAGCTCAGGTTGCTACCATTGAACAAGCAAGTGTTGAAGAAACAGCTCCTGTTGTCATTGTGACTGGAGCCTCTAG...

Protein

Download Protein FASTA

1471 aa · LXL04_025644|LXL04_025644|OH1004|PROTEIN

MAASASFAGSAVAAFKSTGISEKSALGRVSFFRNNASSLQLQRSFNYSQCRSKMSFASSGVKAQVATIEQASVEETAPVVIVTGASRGIGKAVALALGKAGCKVLVNYARSSKEAEEVCKEIESVGGQALTFGGDVSKEEDVASMIKTAVDAWGTVDVLVNNAGITRDGLLMRMKTSQWQEVIDLNLTGVFLCTQAAAKVMMKKKKGRIINMASVVGLVGNVGQANYSAAKAGVIGFTKTVAKEYSSRNINVNAIAPGFI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025644`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025644

Location Chr05:114661468-114671566 (+)

Description Similar to CLKR27: 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24360`	3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025644 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

bna:106367337

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.309

Rank 1 · LXL04_025644 · OH-1004

Cytoplasm0.282

Rank 2 · LXL04_025644 · OH-1004

Peroxisome0.182

Rank 3 · LXL04_025644 · OH-1004

Mitochondrion0.156

Rank 4 · LXL04_025644 · OH-1004

Nucleus0.111

Rank 5 · LXL04_025644 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short79-271 aa

PF08659.17KR80-255 aa

PF13561.13adh_short_C284-318 aa

PF00106.32adh_short701-893 aa

PF08659.17KR703-872 aa

PF13561.13adh_short_C2706-906 aa

PF14291.12DUF43711048-1242 aa

PF27073.1FAM200-ZBED5_RNase-like1160-1249 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025644	`PF00106.32`	adh_short	79	271	7.6e-129	427.6
LXL04_025644	`PF08659.17`	KR	80	255	3.6e-41	141.8
LXL04_025644	`PF13561.13`	adh_short_C2	84	318	9.9e-121	402.4
LXL04_025644	`PF00106.32`	adh_short	701	893	7.6e-129	427.6
LXL04_025644	`PF08659.17`	KR	703	872	3.6e-41	141.8
LXL04_025644	`PF13561.13`	adh_short_C2	706	906	9.9e-121	402.4
LXL04_025644	`PF14291.12`	DUF4371	1048	1242	3.2e-66	224.0
LXL04_025644	`PF27073.1`	FAM200-ZBED5_RNase-like	1160	1249	4.9e-08	33.5
LXL04_025644	`PF13561.13`	adh_short_C2	1422	1469	9.9e-121	402.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P33207`	Arabidopsis thaliana	3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic	72.662%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card