TkAUNG065790 | RubberDandelionOmics

Gene overview

TkAUNG065790

Reference: TK1151 Chr: ChrUn Coordinates: 19088103-19089185 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

426 bp · TkAUNG065790|TK1151|cDNA

ATGATAGTGAACTTGATCTTGAAGAAGGATTATCATCAGACCTTGATTTTGGTAATCATCAATTATTTGCTTTTTTTTTTTTTGATAATGATGATAAGGAGGATGAGAGTGAGAATGATGCAGAGGATATTGAAGGTGGAGAGGATGAGTTCATATTCAGATGCCCTAAACAATGAATTGAAGGCTACTACACTTGATAAAACATTTGTTCATGCACAAGAACAATCCTCCAAAAAGAATGATGAGGGAAGTTCGAGTGT...

CDS

Download CDS FASTA

426 bp · TkAUNG065790|TK1151|CDS

ATGATAGTGAACTTGATCTTGAAGAAGGATTATCATCAGACCTTGATTTTGGTAATCATCAATTATTTGCTTTTTTTTTTTTTGATAATGATGATAAGGAGGATGAGAGTGAGAATGATGCAGAGGATATTGAAGGTGGAGAGGATGAGTTCATATTCAGATGCCCTAAACAATGAATTGAAGGCTACTACACTTGATAAAACATTTGTTCATGCACAAGAACAATCCTCCAAAAAGAATGATGAGGGAAGTTCGAGTGT...

Protein

Download Protein FASTA

141 aa · TkAUNG065790|TK1151|PROTEIN

MIVNLILKKDYHQTLILVIINYLLFFFLIMMIRRMRVRMMQRILKVERMSSYSDALNNELKATTLDKTFVHAQEQSSKKNDEGSSSVNDEMEDELTPVDVDFNLVNFFLDSYSSQEGLSSPASNLLGLMGLRLPDDVAKGK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG065790`
TK1151 ID	TkAUNG065790
OH-1004 ID	LXL04_014011
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	67.400
Protein coverage (%)	TK1151 62.411 / OH-1004 14.125 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG065790

Location ChrUn:19088103-19089185 (-)

Description Similar to At5g65490: Protein ecdysoneless homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65490`	Protein ecdysoneless homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014011 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007281 germ cell development Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009608 response to symbiont Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:2000045 regulation of G1/S transition of mitotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G65490

ddi:DDB_G0287829

dme:Dmel_CG5714

hsa:11319

mmu:70601

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.473

Rank 1 · TkAUNG065790 · TK1151

Nucleus0.312

Rank 2 · TkAUNG065790 · TK1151

Peroxisome0.213

Rank 3 · TkAUNG065790 · TK1151

Mitochondrion0.109

Rank 4 · TkAUNG065790 · TK1151

Endoplasmic reticulum0.074

Rank 5 · TkAUNG065790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08496Peptidase_S49_N14-90 aa

PF07093SGT145-101 aa

PF07093SGT1108-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG065790	`PF08496`	Peptidase_S49_N	14	90	0.0029	18.4
TkAUNG065790	`PF07093`	SGT1	45	101	2.3e-08	33.8
TkAUNG065790	`PF07093`	SGT1	108	123	2.3e-08	33.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSM5`	Arabidopsis thaliana	sp\|Q9LSM5\|ECD_ARATH Protein ecdysoneless homolog	61.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card