LXL04_014011 | RubberDandelionOmics

Gene overview

LXL04_014011

Reference: OH-1004 Chr: Chr03 Coordinates: 40478215-40480312 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1872 bp · LXL04_014011|LXL04_014011|OH1004|cDNA

ATGTCAGACATCTTCTCCCACAAAACCTCTAGACTCCCCGAAGACACCGTCTTCTTCACCATATTCCCCGACTCCTCTCTTTCCCAAAATCCCCAAACTACCCCTCCCCTCCCATCTCTCCACCTCCAAATCCTCCAATATCTCTCCCAATACACCACCAATTACATATGGCAACACGAACCCTTCACTCTCTCCCCTTCCACCCAATCCCCTTGCTCCTTCTGCCCTTCAAACCATCCCCCCCACCTTCATGGCAAACT...

CDS

Download CDS FASTA

1872 bp · LXL04_014011|LXL04_014011|OH1004|CDS

ATGTCAGACATCTTCTCCCACAAAACCTCTAGACTCCCCGAAGACACCGTCTTCTTCACCATATTCCCCGACTCCTCTCTTTCCCAAAATCCCCAAACTACCCCTCCCCTCCCATCTCTCCACCTCCAAATCCTCCAATATCTCTCCCAATACACCACCAATTACATATGGCAACACGAACCCTTCACTCTCTCCCCTTCCACCCAATCCCCTTGCTCCTTCTGCCCTTCAAACCATCCCCCCCACCTTCATGGCAAACT...

Protein

Download Protein FASTA

623 aa · LXL04_014011|LXL04_014011|OH1004|PROTEIN

MSDIFSHKTSRLPEDTVFFTIFPDSSLSQNPQTTPPLPSLHLQILQYLSQYTTNYIWQHEPFTLSPSTQSPCSFCPSNHPPHLHGKLRYGDNLEDEWFTVFLLFQTSQKHPNLSIQIWDTDGEFLLIESAFHLPKWVNPETTTNRIFIRNGNLHIIPKSHFPSNPTLETSLSFLIQHENESKASDSVQSAIKTRILDYPDKAIKNMHRVRVRVPVLVAQILKHEPCLISLSVEGFYDRDIDSMKHAAKMERFLPNKSSNE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014011`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014011

Location Chr03:40478215-40480312 (-)

Description Similar to At5g65490: Protein ecdysoneless homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g65490`	Protein ecdysoneless homolog.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014011 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0007030 Golgi organization Biological Process

GO:0007281 germ cell development Biological Process

GO:0008283 cell population proliferation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009608 response to symbiont Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:2000045 regulation of G1/S transition of mitotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G65490

ddi:DDB_G0287829

dme:Dmel_CG5714

hsa:11319

mmu:70601

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.781

Rank 1 · LXL04_014011 · OH-1004

Nucleus0.360

Rank 2 · LXL04_014011 · OH-1004

Peroxisome0.096

Rank 3 · LXL04_014011 · OH-1004

Golgi apparatus0.063

Rank 4 · LXL04_014011 · OH-1004

Endoplasmic reticulum0.054

Rank 5 · LXL04_014011 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07093.17SGT117-584 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014011	`PF07093.17`	SGT1	17	584	4.2e-187	624.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSM5`	Arabidopsis thaliana	Protein ecdysoneless homolog	56.358%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card