TkAUNG063310 | RubberDandelionOmics

Gene overview

TkAUNG063310

Reference: TK1151 Chr: ChrUn Coordinates: 18276057-18277739 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1620 bp · TkAUNG063310|TK1151|cDNA

ATGGACGTTGGATTCAAAGATATTAATGGAAACCATTTGGGCGTGAATCTTAATTCGATGGTTTCAACCGACGTCGCCGATTTGGATTCGGCCAACATTGATCTGAGAAGCGGCGACCAAATTAACTCGTGGGTGGAGTACAACGGCTCAACTCAGCAACTCAACGTCTCGATTTCATATTCCAACATAAAACCAACCTCCCCAGTTTTATCAATCCCCTTGGATCTTAACAAATACGTGAACGAATTCATGTTCATCGG...

CDS

Download CDS FASTA

1620 bp · TkAUNG063310|TK1151|CDS

ATGGACGTTGGATTCAAAGATATTAATGGAAACCATTTGGGCGTGAATCTTAATTCGATGGTTTCAACCGACGTCGCCGATTTGGATTCGGCCAACATTGATCTGAGAAGCGGCGACCAAATTAACTCGTGGGTGGAGTACAACGGCTCAACTCAGCAACTCAACGTCTCGATTTCATATTCCAACATAAAACCAACCTCCCCAGTTTTATCAATCCCCTTGGATCTTAACAAATACGTGAACGAATTCATGTTCATCGG...

Protein

Download Protein FASTA

539 aa · TkAUNG063310|TK1151|PROTEIN

MDVGFKDINGNHLGVNLNSMVSTDVADLDSANIDLRSGDQINSWVEYNGSTQQLNVSISYSNIKPTSPVLSIPLDLNKYVNEFMFIGFTGSTQGSTEVHSVEWWTFNSSFVKSPPPSMAPTQSNSTPTHHSTQKKSKCNNQLCKQGAGAVVGVVTASAFVLAACALFLIWLYSKKFKSAKKPQLFASEIIKTPKEFSYKELKLATKGFDPTRVIGHGAFGTVYRGVLSESGETIAVKRCSHTGGQGMAEFLSELSIIGTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG063310`
TK1151 ID	TkAUNG063310
OH-1004 ID	LXL04_032685
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.500
Protein coverage (%)	TK1151 100.000 / OH-1004 79.659 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG063310

Location ChrUn:18276057-18277739 (+)

Description Similar to LECRK81: L-type lectin-domain containing receptor kinase VIII.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53380`	L-type lectin-domain containing receptor kinase VIII.1.	No verified direct reference in this release
`At5g03140`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici.	No verified direct reference in this release
`At5g55830`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici.	No verified direct reference in this release
`At3g55550`	Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae.	No verified direct reference in this release
`At2g37710`	L-type lectin-domain containing receptor kinase IV.1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032685 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT2G37710

ath:AT3G53380

ath:AT5G03140

ath:AT5G42120

ath:AT5G55830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.851

Rank 1 · TkAUNG063310 · TK1151

Cytoplasm0.095

Rank 2 · TkAUNG063310 · TK1151

Endoplasmic reticulum0.076

Rank 3 · TkAUNG063310 · TK1151

Nucleus0.062

Rank 4 · TkAUNG063310 · TK1151

Golgi apparatus0.026

Rank 5 · TkAUNG063310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00139Lectin_legB5-114 aa

PF18483Lectin_L-type_dom34-102 aa

PF07178TraL147-184 aa

PF00069Pkinase211-480 aa

PF07714PK_Tyr_Ser-Thr212-482 aa

PF03109ABC1213-238 aa

PF07387Seadorna_VP7307-350 aa

PF17667Pkinase_fungal309-382 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG063310	`PF00139`	Lectin_legB	5	114	7.4e-30	105.0
TkAUNG063310	`PF18483`	Lectin_L-type_dom	34	102	0.054	14.1
TkAUNG063310	`PF07178`	TraL	147	184	0.34	12.0
TkAUNG063310	`PF00069`	Pkinase	211	480	3.5e-49	168.3
TkAUNG063310	`PF07714`	PK_Tyr_Ser-Thr	212	482	6.5e-46	157.4
TkAUNG063310	`PF03109`	ABC1	213	238	0.00043	20.2
TkAUNG063310	`PF07387`	Seadorna_VP7	307	350	0.072	12.8
TkAUNG063310	`PF17667`	Pkinase_fungal	309	382	0.00039	20.0
TkAUNG063310	`PF14531`	Kinase-like	316	412	0.039	13.9
TkAUNG063310	`PF03109`	ABC1	317	360	0.00043	20.2
TkAUNG063310	`PF01636`	APH	317	343	0.26	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFH9`	Arabidopsis thaliana	sp\|Q9LFH9\|LRK81_ARATH L-type lectin-domain containing receptor kinase VIII.1	65.300%	Swiss-Prot	High
`Q9LYX1`	Arabidopsis thaliana	sp\|Q9LYX1\|LRK82_ARATH L-type lectin-domain containing receptor kinase VIII.2	64.700%	Swiss-Prot	High
`Q9FHG4`	Arabidopsis thaliana	sp\|Q9FHG4\|LRKS7_ARATH Probable L-type lectin-domain containing receptor kinase S.7	50.400%	Swiss-Prot	High
`Q9M2S4`	Arabidopsis thaliana	sp\|Q9M2S4\|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.4	40.700%	Swiss-Prot	Medium
`O80939`	Arabidopsis thaliana	sp\|O80939\|LRK41_ARATH L-type lectin-domain containing receptor kinase IV.1	39.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card