TkAUNG061120 | RubberDandelionOmics

Gene overview

TkAUNG061120

Reference: TK1151 Chr: ChrUn Coordinates: 17780253-17783001 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

993 bp · TkAUNG061120|TK1151|cDNA

ATGGACTCCGCCAAGATTAAGGTCATCGGCGTCGGTGGCGGTGGTAACAATGCCGTTAATCGCATGATTGGCAGTGGCTTACAGGGAGTAGACTTCTATGCCGTAAACACAGATGCTCAGGCTCTTTTGCAATCTGCTGCACAGAACCCTATTCAGATTGGCGAACTTTTGACTCGTGGACTTGGTACTGGAGGAAATCCACTTTTGGGTGAACAGGCAGCAGAGGAATCAAAGGAAACCATCGCGAATTCTCTCAGGGG...

CDS

Download CDS FASTA

993 bp · TkAUNG061120|TK1151|CDS

ATGGACTCCGCCAAGATTAAGGTCATCGGCGTCGGTGGCGGTGGTAACAATGCCGTTAATCGCATGATTGGCAGTGGCTTACAGGGAGTAGACTTCTATGCCGTAAACACAGATGCTCAGGCTCTTTTGCAATCTGCTGCACAGAACCCTATTCAGATTGGCGAACTTTTGACTCGTGGACTTGGTACTGGAGGAAATCCACTTTTGGGTGAACAGGCAGCAGAGGAATCAAAGGAAACCATCGCGAATTCTCTCAGGGG...

Protein

Download Protein FASTA

330 aa · TkAUNG061120|TK1151|PROTEIN

MDSAKIKVIGVGGGGNNAVNRMIGSGLQGVDFYAVNTDAQALLQSAAQNPIQIGELLTRGLGTGGNPLLGEQAAEESKETIANSLRGSDMVFITAGMGGGTGSGAAPVVAQIAKEAGYLTVGVVTYPFSFEGRKRSVQALEAIEKLQKNVDTLIVIPNDRLLDIADEQTPLQDAFLLADDVLRQGVQGISDIITIPGLVNVDFADVKAVMKDSGTAMLGVGVSSSKNRAEEAAEQATLAPLIGSSIQSATGVVYNITGGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG061120`
TK1151 ID	TkAUNG061120
OH-1004 ID	LXL04_037300
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.800
Protein coverage (%)	TK1151 96.970 / OH-1004 79.493 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG061120

Location ChrUn:17780253-17783001 (+)

Description Similar to FTSZ1: Cell division protein FtsZ homolog 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55280`	Exhibits GTPase activity.	Chloroplast division and morphology are differentially affected by overexpression of FtsZ1 and FtsZ2 genes in Arabidopsis.2000 · DOI: 10.1104/pp.124.4.1668 Effects of mutations in Arabidopsis FtsZ1 on plastid division, FtsZ ring formation and positioning, and FtsZ filament morphology in vivo.2007 · DOI: 10.1093/pcp/pcm049 Developmentally regulated association of plastid division protein FtsZ1 with thylakoid membranes in Arabidopsis thaliana.2008 · DOI: 10.1042/bj20070543 Plant FtsZ1 and FtsZ2 expressed in a eukaryotic host: GTPase activity and self-assembly.2010 · DOI: 10.1016/j.febslet.2009.11.044 FtsZ1/FtsZ2 Turnover in Chloroplasts and the Role of ARC3.2015 · DOI: 10.1017/s1431927615000082 The Arabidopsis minE mutation causes new plastid and FtsZ1 localization phenotypes in the leaf epidermis.2015 · DOI: 10.3389/fpls.2015.00823 Differential impacts of FtsZ proteins on plastid division in the shoot apex of Arabidopsis.2018 · DOI: 10.1016/j.ydbio.2018.06.010 Chloroplast division in higher plants requires members of two functionally divergent gene families with homology to bacterial ftsZ.1998 · DOI: 10.1105/tpc.10.12.1991
`At2g36250`	Exhibits GTPase activity which converts GTP ligands to GDP.	Chloroplast division and morphology are differentially affected by overexpression of FtsZ1 and FtsZ2 genes in Arabidopsis.2000 · DOI: 10.1104/pp.124.4.1668 Plant FtsZ1 and FtsZ2 expressed in a eukaryotic host: GTPase activity and self-assembly.2010 · DOI: 10.1016/j.febslet.2009.11.044 Arabidopsis FtsZ2-1 and FtsZ2-2 are functionally redundant, but FtsZ-based plastid division is not essential for chloroplast partitioning or plant growth and development.2009 · DOI: 10.1093/mp/ssp077 Differential impacts of FtsZ proteins on plastid division in the shoot apex of Arabidopsis.2018 · DOI: 10.1016/j.ydbio.2018.06.010 Chloroplast division in higher plants requires members of two functionally divergent gene families with homology to bacterial ftsZ.1998 · DOI: 10.1105/tpc.10.12.1991

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037300 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0009612 response to mechanical stimulus Biological Process

GO:0009637 response to blue light Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009902 chloroplast relocation Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0032506 cytokinetic process Biological Process

GO:0043093 FtsZ-dependent cytokinesis Biological Process

GO:0043572 plastid fission Biological Process

GO:0051258 protein polymerization Biological Process

GO:0051301 cell division Biological Process

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ana:alr3858

ath:AT3G52750

ath:AT5G55280

bha:BH2558

syn:sll1633

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.360

Rank 1 · TkAUNG061120 · TK1151

Cytoplasm0.286

Rank 2 · TkAUNG061120 · TK1151

Plastid0.238

Rank 3 · TkAUNG061120 · TK1151

Nucleus0.112

Rank 4 · TkAUNG061120 · TK1151

Cell membrane0.043

Rank 5 · TkAUNG061120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00091Tubulin5-165 aa

PF13809Tubulin_28-40 aa

PF13809Tubulin_287-177 aa

PF12327FtsZ_C89-89 aa

PF26334Gtf3_N101-154 aa

PF00091Tubulin203-228 aa

PF26334Gtf3_N205-250 aa

PF12327FtsZ_C214-307 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG061120	`PF00091`	Tubulin	5	165	2.6e-51	175.4
TkAUNG061120	`PF13809`	Tubulin_2	8	40	0.047	13.6
TkAUNG061120	`PF13809`	Tubulin_2	87	177	0.047	13.6
TkAUNG061120	`PF12327`	FtsZ_C	89	89	3.5e-30	104.9
TkAUNG061120	`PF26334`	Gtf3_N	101	154	0.24	11.9
TkAUNG061120	`PF00091`	Tubulin	203	228	2.6e-51	175.4
TkAUNG061120	`PF26334`	Gtf3_N	205	250	0.24	11.9
TkAUNG061120	`PF12327`	FtsZ_C	214	307	3.5e-30	104.9
TkAUNG061120	`PF00692`	dUTPase	232	275	0.074	13.5
TkAUNG061120	`PF00692`	dUTPase	283	305	0.074	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42545`	Arabidopsis thaliana	sp\|Q42545\|FTSZ1_ARATH Cell division protein FtsZ homolog 1, chloroplastic	92.600%	Swiss-Prot	High
`O82533`	Arabidopsis thaliana	sp\|O82533\|FTZ21_ARATH Cell division protein FtsZ homolog 2-1, chloroplastic	61.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card