TkAUNG039130 | RubberDandelionOmics

Gene overview

TkAUNG039130

Reference: TK1151 Chr: ChrUn Coordinates: 10892491-10895147 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1182 bp · TkAUNG039130|TK1151|cDNA

ATGGCGACCGCTGCTAAAAAGGTTTTGGTGCCGGTGGCGAACGGCACGGAGCCGCTGGAGGCGGTGATAACAATCGATGTTCTTCGGAGAGCCGGCGCCGATGTTACGGTAGCGTCGGTGGAGAAACAGCTAGGCGTTGACGCATGCCACGGCATCAAAATCGTCGCCGATGCTCTTATTTCTGACTGCGCGGATACTACTTTTGATCTAATCTCTCTTCCGGGAGGAATGCCTGGTGCAGCCACTTTTAGGGATTGCAA...

CDS

Download CDS FASTA

1182 bp · TkAUNG039130|TK1151|CDS

ATGGCGACCGCTGCTAAAAAGGTTTTGGTGCCGGTGGCGAACGGCACGGAGCCGCTGGAGGCGGTGATAACAATCGATGTTCTTCGGAGAGCCGGCGCCGATGTTACGGTAGCGTCGGTGGAGAAACAGCTAGGCGTTGACGCATGCCACGGCATCAAAATCGTCGCCGATGCTCTTATTTCTGACTGCGCGGATACTACTTTTGATCTAATCTCTCTTCCGGGAGGAATGCCTGGTGCAGCCACTTTTAGGGATTGCAA...

Protein

Download Protein FASTA

393 aa · TkAUNG039130|TK1151|PROTEIN

MATAAKKVLVPVANGTEPLEAVITIDVLRRAGADVTVASVEKQLGVDACHGIKIVADALISDCADTTFDLISLPGGMPGAATFRDCKALENIARKQAAEDRPYAAICAAPAVALGSWGLLKGLKATCYPSFMEVLSSSASAVESRVQQDGKVVTSRGPGTAIEYAVALVELLYGKEKAAEVSGPLVMRSNNADEHTFTELNPVKWTFDTSPQILVPIANGSEEMEAVIIIDVLRRAKAQVVVASIESELEILASRKVKLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG039130`
TK1151 ID	TkAUNG039130
OH-1004 ID	LXL04_016599
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	74.800
Protein coverage (%)	TK1151 99.746 / OH-1004 90.345 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG039130

Location ChrUn:10892491-10895147 (-)

Description Similar to DJ1B: Protein DJ-1 homolog B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53280`	May be involved in oxidative stress response.	No verified direct reference in this release
`At3g14990`	Involved in oxidative stress response.	No verified direct reference in this release
`At4g34020`	Plays an essential role in chloroplast development and is required for chloroplast integrity and viability.	A plant DJ-1 homolog is essential for Arabidopsis thaliana chloroplast development.2011 · DOI: 10.1371/journal.pone.0023731

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016599 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0010310 regulation of hydrogen peroxide metabolic process Biological Process

GO:0034614 cellular response to reactive oxygen species Biological Process

GO:0046295 glycolate biosynthetic process Biological Process

GO:0048640 negative regulation of developmental growth Biological Process

GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction Biological Process

GO:1900409 positive regulation of cellular response to oxidative stress Biological Process

GO:1903189 glyoxal metabolic process Biological Process

GO:1905446 regulation of mitochondrial ATP synthesis coupled electron transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G53280

ath:AT3G14990

ath:AT4G34020

dme:Dmel_CG1349

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.698

Rank 1 · TkAUNG039130 · TK1151

Nucleus0.358

Rank 2 · TkAUNG039130 · TK1151

Mitochondrion0.120

Rank 3 · TkAUNG039130 · TK1151

Cell membrane0.088

Rank 4 · TkAUNG039130 · TK1151

Endoplasmic reticulum0.061

Rank 5 · TkAUNG039130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23340Chp1_domII5-32 aa

PF26299MurL_N5-49 aa

PF01965DJ-1_PfpI6-170 aa

PF07685GATase_366-108 aa

PF26299MurL_N211-258 aa

PF01965DJ-1_PfpI212-374 aa

PF23340Chp1_domII212-270 aa

PF07685GATase_3248-313 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG039130	`PF23340`	Chp1_domII	5	32	0.27	12.3
TkAUNG039130	`PF26299`	MurL_N	5	49	0.44	10.4
TkAUNG039130	`PF01965`	DJ-1_PfpI	6	170	3e-87	291.3
TkAUNG039130	`PF07685`	GATase_3	66	108	0.045	14.1
TkAUNG039130	`PF26299`	MurL_N	211	258	0.44	10.4
TkAUNG039130	`PF01965`	DJ-1_PfpI	212	374	3e-87	291.3
TkAUNG039130	`PF23340`	Chp1_domII	212	270	0.27	12.3
TkAUNG039130	`PF07685`	GATase_3	248	313	0.045	14.1
TkAUNG039130	`PF10994`	DUF2817	252	305	0.36	11.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAH3`	Arabidopsis thaliana	sp\|Q9MAH3\|DJ1B_ARATH Protein DJ-1 homolog B	71.000%	Swiss-Prot	High
`Q9FPF0`	Arabidopsis thaliana	sp\|Q9FPF0\|DJ1A_ARATH Protein DJ-1 homolog A	63.400%	Swiss-Prot	High
`Q8VY09`	Arabidopsis thaliana	sp\|Q8VY09\|DJ1C_ARATH Protein DJ-1 homolog C	45.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card