TkAUNG039050 | RubberDandelionOmics

Gene overview

TkAUNG039050

Reference: TK1151 Chr: ChrUn Coordinates: 10861701-10862438 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

690 bp · TkAUNG039050|TK1151|cDNA

ATGGATTTGGGTACAATTAAGACTAGACTGTCACAAAATCTCTACAAGTCTCCAAGGGAGTTTGCTGAGGATGTCAGACTTGTTTTTCACAATGCCATGACTTATAATCCAAAGGGGCAAGATGTGCATGTTATGGCAGAGACATTATTGCAGATTTTTGAGGAGAGATGGGCAATTATAGAGGCTGAGTACCATCCTTATTGGAAATATCAAGTGTATCAGGATGGTGGTGTGCCCACTCCCCCTTCCAATGTTCCTGC...

CDS

Download CDS FASTA

690 bp · TkAUNG039050|TK1151|CDS

ATGGATTTGGGTACAATTAAGACTAGACTGTCACAAAATCTCTACAAGTCTCCAAGGGAGTTTGCTGAGGATGTCAGACTTGTTTTTCACAATGCCATGACTTATAATCCAAAGGGGCAAGATGTGCATGTTATGGCAGAGACATTATTGCAGATTTTTGAGGAGAGATGGGCAATTATAGAGGCTGAGTACCATCCTTATTGGAAATATCAAGTGTATCAGGATGGTGGTGTGCCCACTCCCCCTTCCAATGTTCCTGC...

Protein

Download Protein FASTA

229 aa · TkAUNG039050|TK1151|PROTEIN

MDLGTIKTRLSQNLYKSPREFAEDVRLVFHNAMTYNPKGQDVHVMAETLLQIFEERWAIIEAEYHPYWKYQVYQDGGVPTPPSNVPAAPQIRPEPMTSSMAVDLKTHRPHVGRTPVPKKPKAKDPNKRDMTYDEKQRLSTNLQGLPTEKLDAIVQIIKKRNTALSQHDDEIEVDIDSVDAETLWELDRFVTNYKKSLSKNKRKAELALQARTSANQNVASTVRGDDSLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG039050`
TK1151 ID	TkAUNG039050
OH-1004 ID	LXL04_037716
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	68.200
Protein coverage (%)	TK1151 91.703 / OH-1004 32.632 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG039050

Location ChrUn:10861701-10862438 (+)

Description Similar to GTE4: Transcription factor GTE4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06230`	Involved in the activation and maintenance of cell division in the meristems and by this controls cell numbers in differentiated organs.	The Arabidopsis BET bromodomain factor GTE4 is involved in maintenance of the mitotic cell cycle during plant development.2010 · DOI: 10.1104/pp.109.150631 The Arabidopsis BET bromodomain factor GTE4 regulates the mitotic cell cycle.2010 · DOI: 10.4161/psb.5.6.11571
`At1g73150`	Probable transcription factor that binds to acetylated histone H3.	The PHD domain of plant PIAS proteins mediates sumoylation of bromodomain GTE proteins.2008 · DOI: 10.1074/jbc.m708176200
`At1g17790`	Transcription factor GTE5, chloroplastic.	No verified direct reference in this release
`At5g10550`	Transcription factor GTE2.	No verified direct reference in this release
`At5g65630`	Transcription factor GTE7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037716 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009294 DNA-mediated transformation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0045931 positive regulation of mitotic cell cycle Biological Process

GO:0048364 root development Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003682 chromatin binding Molecular Function

KEGG gene cross-reference

ath:AT1G06230

ath:AT1G17790

ath:AT1G73150

ath:AT3G27260

ath:AT5G14270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.923

Rank 1 · TkAUNG039050 · TK1151

Cytoplasm0.193

Rank 2 · TkAUNG039050 · TK1151

Cell membrane0.026

Rank 3 · TkAUNG039050 · TK1151

Mitochondrion0.017

Rank 4 · TkAUNG039050 · TK1151

Endoplasmic reticulum0.015

Rank 5 · TkAUNG039050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00439Bromodomain1-47 aa

PF25289DUF78775-34 aa

PF17035BET7-20 aa

PF25289DUF7877113-127 aa

PF17035BET130-191 aa

PF25289DUF7877169-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG039050	`PF00439`	Bromodomain	1	47	5.7e-12	46.2
TkAUNG039050	`PF25289`	DUF7877	5	34	0.048	14.8
TkAUNG039050	`PF17035`	BET	7	20	2.3e-23	82.8
TkAUNG039050	`PF25289`	DUF7877	113	127	0.048	14.8
TkAUNG039050	`PF17035`	BET	130	191	2.3e-23	82.8
TkAUNG039050	`PF25289`	DUF7877	169	217	0.048	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNC4`	Arabidopsis thaliana	sp\|Q9LNC4\|GTE4_ARATH Transcription factor GTE4	59.300%	Swiss-Prot	High
`Q9S7T1`	Arabidopsis thaliana	sp\|Q9S7T1\|GTE3_ARATH Transcription factor GTE3, chloroplastic	50.700%	Swiss-Prot	High
`Q8H1D7`	Arabidopsis thaliana	sp\|Q8H1D7\|GTE5_ARATH Transcription factor GTE5, chloroplastic	44.700%	Swiss-Prot	Medium
`Q9LXA7`	Arabidopsis thaliana	sp\|Q9LXA7\|GTE2_ARATH Transcription factor GTE2	39.700%	Swiss-Prot	Medium
`Q7Y214`	Arabidopsis thaliana	sp\|Q7Y214\|GTE7_ARATH Transcription factor GTE7	40.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card