TkAUNG027900 | RubberDandelionOmics

Gene overview

TkAUNG027900

Reference: TK1151 Chr: ChrUn Coordinates: 7490918-7502311 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2601 bp · TkAUNG027900|TK1151|cDNA

ACCACGGTGGCGGAGGAGGATGTTGTCCACCGATGGATCTGTTCCGTTCAGAACCGATGCACTTGGTACAAATCATCATTCCTATTGAGTCAGCTCACTTGACTGCCTCTTACCTGGGTGATATCGGCCTCATTCAATTCAAAGATCTGAATGCAGACAAAAGCCCTTTTCAACGAACATATGCTGGCCAGATTAAAAGATGCGGAGAAATGGCACGGAAATTGCGTTACTTCAAAGAACAAATGTCAAAGGCGGGCCTG...

CDS

Download CDS FASTA

1908 bp · TkAUNG027900|TK1151|CDS

ATGGATCTGTTCCGTTCAGAACCGATGCACTTGGTACAAATCATCATTCCTATTGAGTCAGCTCACTTGACTGCCTCTTACCTGGGTGATATCGGCCTCATTCAATTCAAAGATCTGAATGCAGACAAAAGCCCTTTTCAACGAACATATGCTGGCCAGATTAAAAGATGCGGAGAAATGGCACGGAAATTGCGTTACTTCAAAGAACAAATGTCAAAGGCGGGCCTGACACCCACACCAAAAACAGAGTCACAAGGTGA...

Protein

Download Protein FASTA

635 aa · TkAUNG027900|TK1151|PROTEIN

MDLFRSEPMHLVQIIIPIESAHLTASYLGDIGLIQFKDLNADKSPFQRTYAGQIKRCGEMARKLRYFKEQMSKAGLTPTPKTESQGDINLDDLEVKLGDLEAELIEVNANSEKLQRGYNELVEYKLVLQKAGEFFRTAESSVVAQHRELASDEIPEESLETPLLTDQETKTDQGKQVKLGVLAGLVAKGKSMAFERILFRATRGNVFLRQSSVDEAVVDPSSGEKVEKNVFLVFYSGERAKNKVLKICEAFGANRYPFVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG027900`
TK1151 ID	TkAUNG027900
OH-1004 ID	LXL04_038219
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 99.055 / OH-1004 76.614 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG027900

Location ChrUn:7490918-7502311 (+)

Description Similar to VHA-a2: V-type proton ATPase subunit a2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21410`	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes.	Arabidopsis V-ATPase activity at the tonoplast is required for efficient nutrient storage but not for sodium accumulation.2010 · DOI: 10.1073/pnas.0913035107
`At4g39080`	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes.	Arabidopsis V-ATPase activity at the tonoplast is required for efficient nutrient storage but not for sodium accumulation.2010 · DOI: 10.1073/pnas.0913035107
`At2g28520`	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes.	Reduced V-ATPase activity in the trans-Golgi network causes oxylipin-dependent hypocotyl growth Inhibition in Arabidopsis.2008 · DOI: 10.1105/tpc.108.058362

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038219 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001503 ossification Biological Process

GO:0006885 regulation of pH Biological Process

GO:0007035 vacuolar acidification Biological Process

GO:0015986 proton motive force-driven ATP synthesis Biological Process

GO:0070070 proton-transporting V-type ATPase complex assembly Biological Process

GO:0097254 renal tubular secretion Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G21410

ath:AT2G28520

ath:AT4G39080

mmu:140494

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.489

Rank 1 · TkAUNG027900 · TK1151

Golgi apparatus0.241

Rank 2 · TkAUNG027900 · TK1151

Cytoplasm0.190

Rank 3 · TkAUNG027900 · TK1151

Lysosome / Vacuole0.127

Rank 4 · TkAUNG027900 · TK1151

Cell membrane0.112

Rank 5 · TkAUNG027900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01496V_ATPase_I27-629 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG027900	`PF01496`	V_ATPase_I	27	629	1.6e-219	731.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJT7`	Arabidopsis thaliana	sp\|Q9SJT7\|VHAA2_ARATH V-type proton ATPase subunit a2	75.800%	Swiss-Prot	High
`Q8W4S4`	Arabidopsis thaliana	sp\|Q8W4S4\|VHAA3_ARATH V-type proton ATPase subunit a3	75.000%	Swiss-Prot	High
`Q8RWZ7`	Arabidopsis thaliana	sp\|Q8RWZ7\|VHAA1_ARATH V-type proton ATPase subunit a1	61.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card