LXL04_038219 | RubberDandelionOmics

Gene overview

LXL04_038219

Reference: OH-1004 Chr: Chr09 Coordinates: 34531279-34536581 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2466 bp · LXL04_038219|LXL04_038219|OH1004|cDNA

ATGGCGGACCACGGTGGCGGAGGAGGATGTTGTCCACCGATGGATCTGTTCCGTTCAGAACCGATGCACTTGGTACAAATCATCATTCCTATTGAGTCAGCTCACTTGACTGCCTCTTACCTGGGTGATATCGGCCTCATTCAATTCAAAGATCTGAATGCAGACAAAAGCCCTTTTCAACGAACATATGCTGGCCAGATTAAAAGATGCGGAGAAATGGCACGGAAATTGCGTTACTTCAAAGAACAAATGTCAAAGGC...

CDS

Download CDS FASTA

2466 bp · LXL04_038219|LXL04_038219|OH1004|CDS

ATGGCGGACCACGGTGGCGGAGGAGGATGTTGTCCACCGATGGATCTGTTCCGTTCAGAACCGATGCACTTGGTACAAATCATCATTCCTATTGAGTCAGCTCACTTGACTGCCTCTTACCTGGGTGATATCGGCCTCATTCAATTCAAAGATCTGAATGCAGACAAAAGCCCTTTTCAACGAACATATGCTGGCCAGATTAAAAGATGCGGAGAAATGGCACGGAAATTGCGTTACTTCAAAGAACAAATGTCAAAGGC...

Protein

Download Protein FASTA

821 aa · LXL04_038219|LXL04_038219|OH1004|PROTEIN

MADHGGGGGCCPPMDLFRSEPMHLVQIIIPIESAHLTASYLGDIGLIQFKDLNADKSPFQRTYAGQIKRCGEMARKLRYFKEQMSKAGLTPTPKTESQGDINLDDLEVKLGDLEAELIEVNANSEKLQRGYNELVEYKLVLQKAGEFFRTAESSVVAQHRELASDEIPEESLETPLLTDQETKTDQGKQVKLGVLAGLVAKGKSMAFERILFRATRGNVFLRQSSVDEAVVDPSSGEKVEKNVFLVFYSGERAKNKVLKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038219`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038219

Location Chr09:34531279-34536581 (+)

Description Similar to VHA-a2: V-type proton ATPase subunit a2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21410`	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes.	Arabidopsis V-ATPase activity at the tonoplast is required for efficient nutrient storage but not for sodium accumulation.2010 · DOI: 10.1073/pnas.0913035107
`At4g39080`	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes.	Arabidopsis V-ATPase activity at the tonoplast is required for efficient nutrient storage but not for sodium accumulation.2010 · DOI: 10.1073/pnas.0913035107
`At2g28520`	Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes.	Reduced V-ATPase activity in the trans-Golgi network causes oxylipin-dependent hypocotyl growth Inhibition in Arabidopsis.2008 · DOI: 10.1105/tpc.108.058362

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038219 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001503 ossification Biological Process

GO:0006885 regulation of pH Biological Process

GO:0007035 vacuolar acidification Biological Process

GO:0015986 proton motive force-driven ATP synthesis Biological Process

GO:0070070 proton-transporting V-type ATPase complex assembly Biological Process

GO:0097254 renal tubular secretion Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G21410

ath:AT2G28520

ath:AT4G39080

mmu:140494

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.358

Rank 1 · LXL04_038219 · OH-1004

Golgi apparatus0.278

Rank 2 · LXL04_038219 · OH-1004

Cytoplasm0.221

Rank 3 · LXL04_038219 · OH-1004

Lysosome / Vacuole0.180

Rank 4 · LXL04_038219 · OH-1004

Cell membrane0.170

Rank 5 · LXL04_038219 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01496.25V_ATPase_I40-813 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038219	`PF01496.25`	V_ATPase_I	40	813	5.9e-303	1007.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJT7`	Arabidopsis thaliana	V-type proton ATPase subunit a2	76.238%	Swiss-Prot	strong database homology
`Q8W4S4`	Arabidopsis thaliana	V-type proton ATPase subunit a3	76.601%	Swiss-Prot	strong database homology
`Q8RWZ7`	Arabidopsis thaliana	V-type proton ATPase subunit a1	63.445%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card