TkAUNG022720 | RubberDandelionOmics

Gene overview

TkAUNG022720

Reference: TK1151 Chr: ChrUn Coordinates: 6056515-6059296 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1876 bp · TkAUNG022720|TK1151|cDNA

AGCAAGTAGCAACACACCCTAACTCGGAGTGCATATGTCACCTTCAGGGGGTTATTTGCAATTAATCATCTTGTATACGAACCCTCGAGCTAACAATACAGAGCTGACGACTGCAGCTGTCGAAGCCCGCCGGGTTCGTCCCAAATTTAAACCCTAAACCCTTCTTCATCAACAAAACTGGGAAATTTAATCAATGGCATACAGGCGTAGTCTCACTATACGGGCGAGACTTTTCGCTCAACAACGATTTGCCCCTTCAT...

CDS

Download CDS FASTA

1377 bp · TkAUNG022720|TK1151|CDS

ATGGCATACAGGCGTAGTCTCACTATACGGGCGAGACTTTTCGCTCAACAACGATTTGCCCCTTCATTCTATTATCTCCATCATGAAGACGATCGTAAGAATTCGCATTCAGATGAAAAAGCAAACACCTTTCTCCAAAGTCGATCATATGGTTGCTACGGTAACAACACCAGCCATTCCTTAGGGTTTGGGGGAGGCGGTGGTGGCGTAAGTTTCCGAGATCCAAGATGGTCGATGGCAACTAGTGGGTTATTGTTAGC...

Protein

Download Protein FASTA

458 aa · TkAUNG022720|TK1151|PROTEIN

MAYRRSLTIRARLFAQQRFAPSFYYLHHEDDRKNSHSDEKANTFLQSRSYGCYGNNTSHSLGFGGGGGGVSFRDPRWSMATSGLLLARNMSTSIGDGVNPDKIEYLTDMADVLADKTMEVVSTQAPVLSEVAVAAADSWPPVAALQYAIDGIHSFTGLNWWASIVITTLVIRTLSVPIMINQLKATTKLTILRPELEQIKQEMQDRGMSPSAVAEGQDKMKKVFKEHGVSTFTPLKGLFIQGPVFVSFFLAIQNMVEKVP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG022720`
TK1151 ID	TkAUNG022720
OH-1004 ID	LXL04_026347
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG022720

Location ChrUn:6056515-6059296 (-)

Description Similar to OXA1: Mitochondrial inner membrane protein OXA1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62050`	Required for the insertion of integral membrane proteins into the mitochondrial inner membrane.	Functional complementation of an oxa1- yeast mutation identifies an Arabidopsis thaliana cDNA involved in the assembly of respiratory complexes.1997 · DOI: 10.1046/j.1365-313x.1997.12061319.x
`At2g46470`	Probably required for the insertion of integral membrane proteins into the mitochondrial inner membrane.	No verified direct reference in this release
`At3g49150`	Putative F-box/LRR-repeat protein At3g49150.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026347 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009060 aerobic respiration Biological Process

GO:0032543 mitochondrial translation Biological Process

GO:0032780 negative regulation of ATP-dependent activity Biological Process

GO:0032979 protein insertion into mitochondrial inner membrane from matrix Biological Process

GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process

GO:0033615 mitochondrial proton-transporting ATP synthase complex assembly Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0051262 protein tetramerization Biological Process

GO:0051354 negative regulation of oxidoreductase activity Biological Process

GO:0065003 protein-containing complex assembly Biological Process

GO:0141164 mitochondrial protein quality control Biological Process

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G46470

ath:AT5G62050

bta:520335

hsa:5018

mmu:69089

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.925

Rank 1 · TkAUNG022720 · TK1151

Nucleus0.038

Rank 2 · TkAUNG022720 · TK1151

Cytoplasm0.030

Rank 3 · TkAUNG022720 · TK1151

Cell membrane0.014

Rank 4 · TkAUNG022720 · TK1151

Plastid0.012

Rank 5 · TkAUNG022720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF0209660KD_IMP152-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG022720	`PF02096`	60KD_IMP	152	353	4.8e-34	118.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42191`	Arabidopsis thaliana	sp\|Q42191\|OXA1_ARATH Mitochondrial inner membrane protein OXA1	48.300%	Swiss-Prot	Medium
`Q9SKD3`	Arabidopsis thaliana	sp\|Q9SKD3\|OXA1L_ARATH Mitochondrial inner membrane protein OXA1-like	50.000%	Swiss-Prot	High
`Q9M3B7`	Arabidopsis thaliana	sp\|Q9M3B7\|FBL54_ARATH Putative F-box/LRR-repeat protein At3g49150	39.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card