Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1423 bp · LXL04_026347|LXL04_026347|OH1004|cDNA
ATGGCATACAGGCGTAGTCTCACTATACGGGCGAGACTTTTCGCTCAACAACGATTTGCCCCTTCATTCTATTATCTCCATCATGAAGACGATCGTAAGAATTCGCATTCAGATCAAAAAGCAAACACCTTTCTCCAAAGTCGATCATATGGTTGCTACGGTAACAACACCAGCCATTCCTTAGGGTTTGGGGGAGGCGGTGGTGGCGTAAGTTTCCGAGATCCAAGATGGTCGATGGCAACTAGTGGCTTATTGTTAGC...
1377 bp · LXL04_026347|LXL04_026347|OH1004|CDS
ATGGCATACAGGCGTAGTCTCACTATACGGGCGAGACTTTTCGCTCAACAACGATTTGCCCCTTCATTCTATTATCTCCATCATGAAGACGATCGTAAGAATTCGCATTCAGATCAAAAAGCAAACACCTTTCTCCAAAGTCGATCATATGGTTGCTACGGTAACAACACCAGCCATTCCTTAGGGTTTGGGGGAGGCGGTGGTGGCGTAAGTTTCCGAGATCCAAGATGGTCGATGGCAACTAGTGGCTTATTGTTAGC...
Protein
Download Protein FASTA458 aa · LXL04_026347|LXL04_026347|OH1004|PROTEIN
MAYRRSLTIRARLFAQQRFAPSFYYLHHEDDRKNSHSDQKANTFLQSRSYGCYGNNTSHSLGFGGGGGGVSFRDPRWSMATSGLLLARNMSTSIGDGVNPDKIEYLTDMADVLADKTMEVVSTQAPVLSEVAVAAADSWPPVAALQYAIDGIHSFTGLNWWASIVITTLVIRTLSVPIMINQLKATTKLTILRPELEQIKQEMQDRGMSPSAVAEGQDKMKKVFKEHGVSTFTPLKGLFIQGPVFVSFFLAIQNMVEKVP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_026347 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_026347 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:125000876-125003074 (+) | |||||||||
| Description | Similar to OXA1: Mitochondrial inner membrane protein OXA1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009060 aerobic respiration Biological Process GO:0032543 mitochondrial translation Biological Process GO:0032780 negative regulation of ATP-dependent activity Biological Process GO:0032979 protein insertion into mitochondrial inner membrane from matrix Biological Process GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process GO:0033615 mitochondrial proton-transporting ATP synthase complex assembly Biological Process GO:0045039 protein insertion into mitochondrial inner membrane Biological Process GO:0051262 protein tetramerization Biological Process GO:0051354 negative regulation of oxidoreductase activity Biological Process GO:0065003 protein-containing complex assembly Biological Process GO:0141164 mitochondrial protein quality control Biological Process GO:0005739 mitochondrion Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G46470 ath:AT5G62050 bta:520335 hsa:5018 mmu:69089 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02096.2760KD_IMP152-353 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_026347 | PF02096.27 | 60KD_IMP | 152 | 353 | 4.8e-34 | 118.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.