RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG020130
Reference: TK1151 Chr: ChrUn Coordinates: 5399865-5404336 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3110 bp · TkAUNG020130|TK1151|cDNA

CTGGAGGGTAGAGGAGAGCACACACTCACAGAACAACGCAAGACAACGAAAGAGATGGCGGGAGAAAATGCCGGTGGAGAGAACCGTTCCAATCAGTCACCTGCTTCATCAGACCAAGGCGGTAACCCCAATTCAAGCCAATTTAATGGGAATCCACCCTCTACGCCGGATTCCCCCACCTCTGCTGGATTTAATACAGATCAGCTTCCTTTCAATAGCCGCACCTCGGAAAATTACTCTGACTTCGACGACGACGAGGC...

CDS

Download CDS FASTA

2895 bp · TkAUNG020130|TK1151|CDS

ATGGCGGGAGAAAATGCCGGTGGAGAGAACCGTTCCAATCAGTCACCTGCTTCATCAGACCAAGGCGGTAACCCCAATTCAAGCCAATTTAATGGGAATCCACCCTCTACGCCGGATTCCCCCACCTCTGCTGGATTTAATACAGATCAGCTTCCTTTCAATAGCCGCACCTCGGAAAATTACTCTGACTTCGACGACGACGAGGCTGCCGTTGATCCAAATATCATCAGGGATGATATTGAGGATGGCGACGAGGATGA...

Protein

Download Protein FASTA

964 aa · TkAUNG020130|TK1151|PROTEIN

MAGENAGGENRSNQSPASSDQGGNPNSSQFNGNPPSTPDSPTSAGFNTDQLPFNSRTSENYSDFDDDEAAVDPNIIRDDIEDGDEDEGEGEDLFNENYIDDYRRLDEHDQYESVGLDDSLEDERDLDQIMADRRAAEIELDTREGVASRAKLPHLLNDQDTDDDSYRPSKRTRAPPGPRGGDDNDAMQSSPGRSQRNNLSGEDIPMTDATDDDQYEDDDNDEGEFEMYRVQGTLREWVTRDEVRRFIAKKFKEFLLTYEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG020130
TK1151 IDTkAUNG020130
OH-1004 IDLXL04_001754
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)32.600
Protein coverage (%)TK1151 66.494 / OH-1004 75.090
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG020130
LocationChrUn:5399865-5404336 (-)
DescriptionSimilar to MCM4: DNA replication licensing factor MCM4
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g44900 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.
The Arabidopsis MCM2 gene is essential to embryo development and its over-expression alters root meristem function.2009 · DOI: 10.1111/j.1469-8137.2009.02961.x
Arabidopsis thaliana MCM2 plays role(s) in mungbean yellow mosaic India virus (MYMIV) DNA replication.2013 · DOI: 10.1007/s00705-012-1563-9

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8BKI8 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells. No verified direct reference in this release
Os11g0484300 Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.
Identification and characterization of a rice MCM2 homologue required for DNA replication.2008 · DOI: 10.5483/bmbrep.2008.41.8.581
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001754 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000727 double-strand break repair via break-induced replication Biological Process
GO:0006260 DNA replication Biological Process
GO:0006270 DNA replication initiation Biological Process
GO:0006271 DNA strand elongation involved in DNA replication Biological Process
GO:0006279 premeiotic DNA replication Biological Process
GO:0009555 pollen development Biological Process
GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process
GO:0033260 nuclear DNA replication Biological Process
GO:0044786 cell cycle DNA replication Biological Process
GO:1902975 mitotic DNA replication initiation Biological Process
GO:0000347 THO complex Cellular Component
GO:0000785 chromatin Cellular Component
KEGG gene cross-reference
ath:AT2G16440
spo:2539164
xla:397843
xtr:448137
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927
Rank 1 · TkAUNG020130 · TK1151
Cytoplasm0.159
Rank 2 · TkAUNG020130 · TK1151
Mitochondrion0.023
Rank 3 · TkAUNG020130 · TK1151
Cell membrane0.017
Rank 4 · TkAUNG020130 · TK1151
Endoplasmic reticulum0.008
Rank 5 · TkAUNG020130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12619MCM2_N66-174 aa
PF14551MCM_N249-342 aa
PF17207MCM_OB348-475 aa
PF09723Zn_ribbon_8382-412 aa
PF12639Colicin-DNase483-531 aa
PF00493MCM516-737 aa
PF01078Mg_chelatase560-588 aa
PF00158Sigma54_activat570-685 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkAUNG020130PF12619MCM2_N661742e-0938.6
TkAUNG020130PF14551MCM_N2493425.8e-1865.8
TkAUNG020130PF17207MCM_OB3484754.6e-35120.8
TkAUNG020130PF09723Zn_ribbon_83824120.02815.2
TkAUNG020130PF12639Colicin-DNase4835310.2213.1
TkAUNG020130PF00493MCM5167378.1e-102339.8
TkAUNG020130PF01078Mg_chelatase5605882.9e-0834.1
TkAUNG020130PF00158Sigma54_activat5706850.01815.4
TkAUNG020130PF07728AAA_55726911.8e-0628.7
TkAUNG020130PF07726AAA_35736880.0005220.6
TkAUNG020130PF01078Mg_chelatase6266942.9e-0834.1
TkAUNG020130PF12619MCM2_N6426612e-0938.6
TkAUNG020130PF17855MCM_lid7748589.1e-2587.7
TkAUNG020130PF23669WHD_MCM28829589.8e-1864.8
TkAUNG020130PF30801DUF499_6th8909540.1613.1
TkAUNG020130PF00158Sigma54_activat9099290.01815.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LPD9Arabidopsis thalianasp|Q9LPD9|MCM2_ARATH DNA replication licensing factor MCM274.500%Swiss-ProtHigh
B8BKI8Oryza sativa subsp. indicasp|B8BKI8|MCM2_ORYSI DNA replication licensing factor MCM275.700%Swiss-ProtHigh
Q2R482Oryza sativa subsp. japonicasp|Q2R482|MCM2_ORYSJ DNA replication licensing factor MCM275.700%Swiss-ProtHigh

JBrowse

View in Genome Browser