TkAUNG017540 | RubberDandelionOmics

Gene overview

TkAUNG017540

Reference: TK1151 Chr: ChrUn Coordinates: 4688950-4689426 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

477 bp · TkAUNG017540|TK1151|cDNA

GTCGGGTCGTATCACGCATCGTCGTTATTAGTAGCATCCAAACCTCCACCACCAGGTGTCGTCAGCCGTGGGATCGGTCTCGAAGGCGTTTCCAGCGTTTTATCCAGTATATGGGGTACAGGAACCGGGTCAACGACTTTGATCGAAAACGTGCACACAATCGGCGTTACAAAAATGGGAAGCCGAAGAACAATCGAATTAGGAGCTTGCGTTTTGATCTTGTTATCCCTTGTGGGTAAAGTAGGAGGACTAATAGCTTC...

CDS

Download CDS FASTA

477 bp · TkAUNG017540|TK1151|CDS

GTCGGGTCGTATCACGCATCGTCGTTATTAGTAGCATCCAAACCTCCACCACCAGGTGTCGTCAGCCGTGGGATCGGTCTCGAAGGCGTTTCCAGCGTTTTATCCAGTATATGGGGTACAGGAACCGGGTCAACGACTTTGATCGAAAACGTGCACACAATCGGCGTTACAAAAATGGGAAGCCGAAGAACAATCGAATTAGGAGCTTGCGTTTTGATCTTGTTATCCCTTGTGGGTAAAGTAGGAGGACTAATAGCTTC...

Protein

Download Protein FASTA

158 aa · TkAUNG017540|TK1151|PROTEIN

VGSYHASSLLVASKPPPPGVVSRGIGLEGVSSVLSSIWGTGTGSTTLIENVHTIGVTKMGSRRTIELGACVLILLSLVGKVGGLIASIPQVMVAGLLCIMWACWIWCPRSQLKWCDFVNKVKVLLGLLSKVKRTVRGCRKRMIFKRNNIIMSYYNIIM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG017540`
TK1151 ID	TkAUNG017540
OH-1004 ID	LXL04_013138
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.300
Protein coverage (%)	TK1151 64.557 / OH-1004 14.592 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG017540

Location ChrUn:4688950-4689426 (-)

Description Similar to NAT12: Nucleobase-ascorbate transporter 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27810`	Nucleobase-ascorbate transporter 12.	No verified direct reference in this release
`At4g38050`	Nucleobase-ascorbate transporter 11.	No verified direct reference in this release
`At2g05760`	Nucleobase-ascorbate transporter 1.	No verified direct reference in this release
`At1g49960`	Nucleobase-ascorbate transporter 4.	No verified direct reference in this release
`At2g34190`	Nucleobase-ascorbate transporter 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013138 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0035344 hypoxanthine transport Biological Process

GO:0098702 adenine import across plasma membrane Biological Process

GO:0098710 guanine import across plasma membrane Biological Process

GO:0098721 uracil import across plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0015207 adenine transmembrane transporter activity Molecular Function

GO:0015208 guanine transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G60030

ath:AT2G05760

ath:AT2G27810

ath:AT2G34190

ath:AT4G38050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.382

Rank 1 · TkAUNG017540 · TK1151

Lysosome / Vacuole0.236

Rank 2 · TkAUNG017540 · TK1151

Cytoplasm0.134

Rank 3 · TkAUNG017540 · TK1151

Cell membrane0.118

Rank 4 · TkAUNG017540 · TK1151

Mitochondrion0.098

Rank 5 · TkAUNG017540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00860Xan_ur_permease1-123 aa

PF11239DUF304061-104 aa

PF11345DUF314769-99 aa

PF04831POPDC1-369-115 aa

PF24635DUF7632104-157 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG017540	`PF00860`	Xan_ur_permease	1	123	6.5e-22	78.5
TkAUNG017540	`PF11239`	DUF3040	61	104	0.65	11.0
TkAUNG017540	`PF11345`	DUF3147	69	99	0.013	16.5
TkAUNG017540	`PF04831`	POPDC1-3	69	115	0.83	10.5
TkAUNG017540	`PF24635`	DUF7632	104	157	0.089	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E7D0`	Arabidopsis thaliana	sp\|Q3E7D0\|NAT12_ARATH Nucleobase-ascorbate transporter 12	66.700%	Swiss-Prot	High
`Q6SZ87`	Arabidopsis thaliana	sp\|Q6SZ87\|NAT11_ARATH Nucleobase-ascorbate transporter 11	52.600%	Swiss-Prot	High
`Q9SHZ3`	Arabidopsis thaliana	sp\|Q9SHZ3\|NAT1_ARATH Nucleobase-ascorbate transporter 1	47.500%	Swiss-Prot	Medium
`P93039`	Arabidopsis thaliana	sp\|P93039\|NAT4_ARATH Nucleobase-ascorbate transporter 4	38.900%	Swiss-Prot	Medium
`Q94C70`	Arabidopsis thaliana	sp\|Q94C70\|NAT2_ARATH Nucleobase-ascorbate transporter 2	41.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card