LXL04_013138 | RubberDandelionOmics

Gene overview

LXL04_013138

Reference: OH-1004 Chr: Chr03 Coordinates: 24674082-24678070 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2100 bp · LXL04_013138|LXL04_013138|OH1004|cDNA

ATGGCGCAGAACTCAGACCCTTCCAAACCTTCAAAACCCGGACCATGGCCTCCTGGTCAGGATTCCAACGACGCACCTGCAATGCCTCCTTCTTCATGGGCCAAACGCACCGGTTTCCGCCCTAGGTTCTCTGGAGAGACCAATGCCAGTGATTCTGGTCAAATTACCAGGCCTCCGGTCGATCTCGAGGCTGGACGCGTCCCCCCAGCCCCTGCCGTGAACGGTACGGCTCCGCCGCCGTCCGCTAATGCTCAGGTACA...

CDS

Download CDS FASTA

2100 bp · LXL04_013138|LXL04_013138|OH1004|CDS

ATGGCGCAGAACTCAGACCCTTCCAAACCTTCAAAACCCGGACCATGGCCTCCTGGTCAGGATTCCAACGACGCACCTGCAATGCCTCCTTCTTCATGGGCCAAACGCACCGGTTTCCGCCCTAGGTTCTCTGGAGAGACCAATGCCAGTGATTCTGGTCAAATTACCAGGCCTCCGGTCGATCTCGAGGCTGGACGCGTCCCCCCAGCCCCTGCCGTGAACGGTACGGCTCCGCCGCCGTCCGCTAATGCTCAGGTACA...

Protein

Download Protein FASTA

699 aa · LXL04_013138|LXL04_013138|OH1004|PROTEIN

MAQNSDPSKPSKPGPWPPGQDSNDAPAMPPSSWAKRTGFRPRFSGETNASDSGQITRPPVDLEAGRVPPAPAVNGTAPPPSANAQVQAQSDKDQSVKKGMEPEGGPARLPPKPGPNRPPANNAAAVETPPAPQPTQRVVRNENALPQTVDDEFVSRHSHMKYELRDTPGLVPIGFYGFQHYLSMLGSLVLIPLVIVPAMGGDHEDMSMVVSTVLFVSGMTTLLQANFGSRLPLIQGPSFVFLAPALAIINSPEFLGLNGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013138`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013138

Location Chr03:24674082-24678070 (-)

Description Similar to NAT12: Nucleobase-ascorbate transporter 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27810`	Nucleobase-ascorbate transporter 12.	No verified direct reference in this release
`At4g38050`	Nucleobase-ascorbate transporter 11.	No verified direct reference in this release
`At2g05760`	Nucleobase-ascorbate transporter 1.	No verified direct reference in this release
`At1g60030`	Nucleobase-ascorbate transporter 7.	No verified direct reference in this release
`At2g34190`	Nucleobase-ascorbate transporter 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013138 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0035344 hypoxanthine transport Biological Process

GO:0098702 adenine import across plasma membrane Biological Process

GO:0098710 guanine import across plasma membrane Biological Process

GO:0098721 uracil import across plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0015207 adenine transmembrane transporter activity Molecular Function

GO:0015208 guanine transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G60030

ath:AT2G05760

ath:AT2G27810

ath:AT2G34190

ath:AT4G38050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.738

Rank 1 · LXL04_013138 · OH-1004

Cytoplasm0.131

Rank 2 · LXL04_013138 · OH-1004

Lysosome / Vacuole0.092

Rank 3 · LXL04_013138 · OH-1004

Endoplasmic reticulum0.081

Rank 4 · LXL04_013138 · OH-1004

Golgi apparatus0.054

Rank 5 · LXL04_013138 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00860.27Xan_ur_permease175-592 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013138	`PF00860.27`	Xan_ur_permease	175	592	1.9e-68	231.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E7D0`	Arabidopsis thaliana	Nucleobase-ascorbate transporter 12	70.113%	Swiss-Prot	strong database homology
`Q6SZ87`	Arabidopsis thaliana	Nucleobase-ascorbate transporter 11	48.006%	Swiss-Prot	moderate database homology
`Q9SHZ3`	Arabidopsis thaliana	Nucleobase-ascorbate transporter 1	38.536%	Swiss-Prot	moderate database homology
`Q0WPE9`	Arabidopsis thaliana	Nucleobase-ascorbate transporter 7	35.599%	Swiss-Prot	moderate database homology
`Q94C70`	Arabidopsis thaliana	Nucleobase-ascorbate transporter 2	35.260%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card