Gene Card
Gene overview
cDNA / CDS / Protein Sequences
739 bp · TkAUNG015030|TK1151|cDNA
CTTTTTTCCAATTTCTATTCAAAAGTAATAAAAGATACAGTCGCATCATCATGTCGACATGACCTAAAACAACCATCAAAATCGTCTTTGCGCGACTGATCGGTTGTAAGTTTGAAGCAAGAAAATCCTTTCCGTTTGGTACTCGCGTGAATATCACATGGCTTCTTTAGACACCGATGTCACCATGGTTCCGGCTGCCGAGGGTTCAGGCGGAGCCGGACCTTCTTCCTCCACGGCGTCCACCTCTTCGTCAATCAAGA...
408 bp · TkAUNG015030|TK1151|CDS
ATGTCACCATGGTTCCGGCTGCCGAGGGTTCAGGCGGAGCCGGACCTTCTTCCTCCACGGCGTCCACCTCTTCGTCAATCAAGAAAGCTAAGCGATTCGAGATCAAAAAATGGAACGCTGTTTCTCTTTGGGCTTGGGATATCGTCGTGGATAACTGCGCGATATGTAGGAATCATATCATGGATCTCTGCATCGAATGTCAAGCTAACCAAGCTAGTGCTACCAGTGAGGAGTGCACAGTTGCTTGGGGTGTCTGTAAT...
Protein
Download Protein FASTA135 aa · TkAUNG015030|TK1151|PROTEIN
MSPWFRLPRVQAEPDLLPPRRPPLRQSRKLSDSRSKNGTLFLFGLGISSWITARYVGIISWISASNVKLTKLVLPVRSAQLLGVSVIMPSTFTVLADGSKPAKSAHWITASGSSRSTVTRTFFHFFHEYTTLFLF
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG015030 |
|---|---|
| TK1151 ID | TkAUNG015030 |
| OH-1004 ID | LXL04_002315 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 85.400 |
| Protein coverage (%) | TK1151 65.926 / OH-1004 60.959Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG015030 |
|---|---|
| Location | ChrUn:3889697-3892464 (+) |
| Description | Similar to RBX1A: RING-box protein 1a |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009867 jasmonic acid mediated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0019005 SCF ubiquitin ligase complex Cellular Component GO:0031461 cullin-RING ubiquitin ligase complex Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function |
| KEGG gene cross-reference | ath:AT5G20570 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.