LXL04_002315 | RubberDandelionOmics

Gene overview

LXL04_002315

Reference: OH-1004 Chr: Chr01 Coordinates: 45976675-45978887 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · LXL04_002315|LXL04_002315|OH1004|cDNA

ATGGCTTCTTTAGACACCGATGTCACCATGGTTCCGGCTGCCGAGGGTTCAGGCGGAGCCGGACCTTCTTCCTCCACGGCGTCCACCTCTTCGTCAATCAAGAAAGCTAAGCGATTCGAGATCAAAAAATGGAACGCTGTTTCTCTTTGGGCTTGGGGTACGTTAATACAAATATCGTCGTGGATAACTGCGCGATATGTAGGAATCATATCATGGATCTCTGCATCGAATGTCAAGCTAACCAAGCTAGTGCTACCAGT...

CDS

Download CDS FASTA

441 bp · LXL04_002315|LXL04_002315|OH1004|CDS

ATGGCTTCTTTAGACACCGATGTCACCATGGTTCCGGCTGCCGAGGGTTCAGGCGGAGCCGGACCTTCTTCCTCCACGGCGTCCACCTCTTCGTCAATCAAGAAAGCTAAGCGATTCGAGATCAAAAAATGGAACGCTGTTTCTCTTTGGGCTTGGGGTACGTTAATACAAATATCGTCGTGGATAACTGCGCGATATGTAGGAATCATATCATGGATCTCTGCATCGAATGTCAAGCTAACCAAGCTAGTGCTACCAGT...

Protein

Download Protein FASTA

146 aa · LXL04_002315|LXL04_002315|OH1004|PROTEIN

MASLDTDVTMVPAAEGSGGAGPSSSTASTSSSIKKAKRFEIKKWNAVSLWAWGTLIQISSWITARYVGIISWISASNVKLTKLVLPVRSAQLLGVSVIMPSTFTVLADGSKPAKSAHWITASGSSRSTVTRTFFHFFHEYTTLFLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002315`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_002315

Location Chr01:45976675-45978887 (-)

Description Similar to RBX1A: RING-box protein 1a

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20570`	Component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002315 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:0031461 cullin-RING ubiquitin ligase complex Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT5G20570

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.341

Rank 1 · LXL04_002315 · OH-1004

Cytoplasm0.313

Rank 2 · LXL04_002315 · OH-1004

Mitochondrion0.166

Rank 3 · LXL04_002315 · OH-1004

Cell membrane0.165

Rank 4 · LXL04_002315 · OH-1004

Endoplasmic reticulum0.163

Rank 5 · LXL04_002315 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940X7`	Arabidopsis thaliana	RING-box protein 1a	57.895%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card