TkAUNG012480 | RubberDandelionOmics

Gene overview

TkAUNG012480

Reference: TK1151 Chr: ChrUn Coordinates: 3103276-3108470 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

912 bp · TkAUNG012480|TK1151|cDNA

ATGGATTTGGACCAGTGGATAGCAAAGGTGAAAGAGGGGCAGCACTTGTCCGAAGATGAGCTTCAGCTGCTCTGCGAATACGTGAAGGAAATTTTGATTGAGGAGTCAAATGTGCAGCCAGTTAATAGCCCAGTCACAGTTTGTGGGGATATCCATGGACAGTTTCATGATTTAATGAAACTTTTCCAAACTGGAGGTCATGTACCTGAAACAAATTACATATTTATGGGAGATTTTGTTGATCGTGGTTATAATAGTCT...

CDS

Download CDS FASTA

912 bp · TkAUNG012480|TK1151|CDS

ATGGATTTGGACCAGTGGATAGCAAAGGTGAAAGAGGGGCAGCACTTGTCCGAAGATGAGCTTCAGCTGCTCTGCGAATACGTGAAGGAAATTTTGATTGAGGAGTCAAATGTGCAGCCAGTTAATAGCCCAGTCACAGTTTGTGGGGATATCCATGGACAGTTTCATGATTTAATGAAACTTTTCCAAACTGGAGGTCATGTACCTGAAACAAATTACATATTTATGGGAGATTTTGTTGATCGTGGTTATAATAGTCT...

Protein

Download Protein FASTA

303 aa · TkAUNG012480|TK1151|PROTEIN

MDLDQWIAKVKEGQHLSEDELQLLCEYVKEILIEESNVQPVNSPVTVCGDIHGQFHDLMKLFQTGGHVPETNYIFMGDFVDRGYNSLEVFTILLLLKARYPANITLLRGNHESRQLTQVYGFYDECQRKYGNANAWRYCTDVFDYLTLSAIIDGTVLCVHGGLSPDVRTIDQIRVIERNCEIPHEGPFCDLMWSDPEDIETWAVSPRGAGWLFGSRVTTEFNHINKLDLVCRAHQLVQEGLKYMFQDKGLVTVWSAPNYC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG012480`
TK1151 ID	TkAUNG012480
OH-1004 ID	LXL04_025230
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.600
Protein coverage (%)	TK1151 99.670 / OH-1004 98.366 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG012480

Location ChrUn:3103276-3108470 (+)

Description Similar to PP2A2: Serine/threonine-protein phosphatase PP2A-2 catalytic subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19980`	Catalytic subunit of protein phosphatase 6 (PP6) (Probable).	A PP6-type phosphatase holoenzyme directly regulates PIN phosphorylation and auxin efflux in Arabidopsis.2012 · DOI: 10.1105/tpc.112.098905 The PP6 phosphatase regulates ABI5 phosphorylation and abscisic acid signaling in Arabidopsis.2013 · DOI: 10.1105/tpc.112.105767 Arabidopsis PP6 phosphatases dephosphorylate PIF proteins to repress photomorphogenesis.2019 · DOI: 10.1073/pnas.1907540116
`At1g50370`	Catalytic subunit of protein phosphatase 6 (PP6) (Probable).	A PP6-type phosphatase holoenzyme directly regulates PIN phosphorylation and auxin efflux in Arabidopsis.2012 · DOI: 10.1105/tpc.112.098905 The PP6 phosphatase regulates ABI5 phosphorylation and abscisic acid signaling in Arabidopsis.2013 · DOI: 10.1105/tpc.112.105767 Arabidopsis PP6 phosphatases dephosphorylate PIF proteins to repress photomorphogenesis.2019 · DOI: 10.1073/pnas.1907540116

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025230 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009903 chloroplast avoidance movement Biological Process

GO:0032000 positive regulation of fatty acid beta-oxidation Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G10430

ath:AT1G59830

ath:AT1G69960

dosa:Os06g0574500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.749

Rank 1 · TkAUNG012480 · TK1151

Nucleus0.495

Rank 2 · TkAUNG012480 · TK1151

Mitochondrion0.064

Rank 3 · TkAUNG012480 · TK1151

Cell membrane0.056

Rank 4 · TkAUNG012480 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkAUNG012480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16891STPPase_N14-35 aa

PF00149Metallophos44-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG012480	`PF16891`	STPPase_N	14	35	0.022	15.9
TkAUNG012480	`PF00149`	Metallophos	44	237	1.1e-46	160.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHE7`	Arabidopsis thaliana	sp\|Q9LHE7\|FYPP3_ARATH Phytochrome-associated serine/threonine-protein phosphatase 3	98.300%	Swiss-Prot	High
`Q9SX52`	Arabidopsis thaliana	sp\|Q9SX52\|FYPP1_ARATH Phytochrome-associated serine/threonine-protein phosphatase 1	98.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card