TkAUNG008030 | RubberDandelionOmics

Gene overview

TkAUNG008030

Reference: TK1151 Chr: ChrUn Coordinates: 2086833-2087480 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · TkAUNG008030|TK1151|cDNA

ATGGGGGGGATAGCCGTCTTTTTTTATGTTATCTCTAAAGTGGGCGGCTTCCTCGGGGCGAAGGCCCTATCTTGCCTTTTGGCAAAGATGGGCTGCTCTTCGACTATGGCCTTCGTAGTTGGCTGTGCTTTTCGAGCGCTCGTCACTACGGGGGCAACACCCTCTCTGGGGCATTGGGTGCTTCCCGGACCTTCTCACGAGCCTCACGTGGCAGAAGAGGTTCCCCAAGAGGGCCCGCGGGCCCATGCGGTTGCGATCCG...

CDS

Download CDS FASTA

648 bp · TkAUNG008030|TK1151|CDS

ATGGGGGGGATAGCCGTCTTTTTTTATGTTATCTCTAAAGTGGGCGGCTTCCTCGGGGCGAAGGCCCTATCTTGCCTTTTGGCAAAGATGGGCTGCTCTTCGACTATGGCCTTCGTAGTTGGCTGTGCTTTTCGAGCGCTCGTCACTACGGGGGCAACACCCTCTCTGGGGCATTGGGTGCTTCCCGGACCTTCTCACGAGCCTCACGTGGCAGAAGAGGTTCCCCAAGAGGGCCCGCGGGCCCATGCGGTTGCGATCCG...

Protein

Download Protein FASTA

215 aa · TkAUNG008030|TK1151|PROTEIN

MGGIAVFFYVISKVGGFLGAKALSCLLAKMGCSSTMAFVVGCAFRALVTTGATPSLGHWVLPGPSHEPHVAEEVPQEGPRAHAVAIRSAPPVDMEVKQPLMQDEQRYAELSDRLNRHLLGRSDQIHSITYEDLIEKQILIEGKLEMALLSEEYTRPRILANRVEIRECLFYKGGVPLKEKTLDLYLKQIQSDPCESVPYRKIQKAINNFEIFFSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG008030`
TK1151 ID	TkAUNG008030
OH-1004 ID	LXL04_002591
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.100
Protein coverage (%)	TK1151 19.535 / OH-1004 1.569 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG008030`
Location	ChrUn:2086833-2087480 (+)
Description	Similar to GRV2: DnaJ homolog subfamily C GRV2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002591` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000578 embryonic axis specification Biological Process GO:0006260 DNA replication Biological Process GO:0006457 protein folding Biological Process GO:0006623 protein targeting to vacuole Biological Process GO:0006897 endocytosis Biological Process GO:0006898 receptor-mediated endocytosis Biological Process GO:0007032 endosome organization Biological Process GO:0007033 vacuole organization Biological Process GO:0009408 response to heat Biological Process GO:0009638 phototropism Biological Process GO:0009660 amyloplast organization Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process
KEGG gene cross-reference	ath:AT2G26890 hsa:23317 pon:100174139 reh:H16_A3088 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.601

Rank 1 · TkAUNG008030 · TK1151

Cytoplasm0.207

Rank 2 · TkAUNG008030 · TK1151

Nucleus0.136

Rank 3 · TkAUNG008030 · TK1151

Cell membrane0.068

Rank 4 · TkAUNG008030 · TK1151

Endoplasmic reticulum0.064

Rank 5 · TkAUNG008030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14122YokU81-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG008030	`PF14122`	YokU	81	139	0.19	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card