TkA08G429040 | RubberDandelionOmics

Gene overview

TkA08G429040

Reference: TK1151 Chr: Chr08 Coordinates: 109021244-109026518 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1068 bp · TkA08G429040|TK1151|cDNA

ATGAAACATATAATATGGATGGCAGTTAACCTAGTAATACTGATTTTATTGTTGGAAGTTGTGGTCACATGCAATGCACGTGTCGTGGGCGATGCTCAGAAGCTTAGGGATCTTGCAGCCAAGTATAACGTTACATGTATTCTGGTGTTTGGTGATTCGAGTGTTGATCCTGGTAACAACAACGATATTCCGAACACATGGCATAAAGGCAATTTCCTACCTTATGGAAAAGATTTCGATCATTCAAACCCAATGGGAAG...

CDS

Download CDS FASTA

1068 bp · TkA08G429040|TK1151|CDS

ATGAAACATATAATATGGATGGCAGTTAACCTAGTAATACTGATTTTATTGTTGGAAGTTGTGGTCACATGCAATGCACGTGTCGTGGGCGATGCTCAGAAGCTTAGGGATCTTGCAGCCAAGTATAACGTTACATGTATTCTGGTGTTTGGTGATTCGAGTGTTGATCCTGGTAACAACAACGATATTCCGAACACATGGCATAAAGGCAATTTCCTACCTTATGGAAAAGATTTCGATCATTCAAACCCAATGGGAAG...

Protein

Download Protein FASTA

355 aa · TkA08G429040|TK1151|PROTEIN

MKHIIWMAVNLVILILLLEVVVTCNARVVGDAQKLRDLAAKYNVTCILVFGDSSVDPGNNNDIPNTWHKGNFLPYGKDFDHSNPMGRFTNSRLSTDMIAEALDYTNLIKAYLDPSLMDEDLLHGVSFASGGSGYDDFTADNITNVISLRKQLSYFREYKIRLRKLVGEETCARIVENAVFVLSMGTNDFLQNYYIDPTRSQAFTIAQYQGFLINCMETYVQEMHSLGVTRLMVVGMEPFGCMPMIKTLRKSVGCDEEMNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G429040`
TK1151 ID	TkA08G429040
OH-1004 ID	LXL04_034719
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 85.634 / OH-1004 80.211 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G429040

Location Chr08:109021244-109026518 (+)

Description Similar to At5g45950: GDSL esterase/lipase At5g45950

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45950`	GDSL esterase/lipase At5g45950.	No verified direct reference in this release
`At5g45960`	GDSL esterase/lipase At5g45960.	No verified direct reference in this release
`At3g16370`	GDSL esterase/lipase APG.	No verified direct reference in this release
`At1g06990`	GDSL esterase/lipase At1g06990.	No verified direct reference in this release
`At4g26790`	GDSL esterase/lipase At4g26790.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034719 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016297 fatty acyl-[ACP] hydrolase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT2G04570

ath:AT2G42990

ath:AT4G26790

ath:AT5G45950

ath:AT5G45960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.353

Rank 1 · TkA08G429040 · TK1151

Lysosome / Vacuole0.280

Rank 2 · TkA08G429040 · TK1151

Endoplasmic reticulum0.162

Rank 3 · TkA08G429040 · TK1151

Cytoplasm0.149

Rank 4 · TkA08G429040 · TK1151

Cell membrane0.076

Rank 5 · TkA08G429040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657Lipase_GDSL47-315 aa

PF23590NOT1_connector212-311 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G429040	`PF00657`	Lipase_GDSL	47	315	2.8e-21	77.4
TkA08G429040	`PF23590`	NOT1_connector	212	311	0.058	13.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ41`	Arabidopsis thaliana	sp\|Q9FJ41\|GDL85_ARATH GDSL esterase/lipase At5g45950	53.000%	Swiss-Prot	High
`Q9FJ40`	Arabidopsis thaliana	sp\|Q9FJ40\|GDL86_ARATH GDSL esterase/lipase At5g45960	42.300%	Swiss-Prot	Medium
`Q9LU14`	Arabidopsis thaliana	sp\|Q9LU14\|APG2_ARATH GDSL esterase/lipase APG	39.900%	Swiss-Prot	Medium
`Q9LMJ3`	Arabidopsis thaliana	sp\|Q9LMJ3\|GDL1_ARATH GDSL esterase/lipase At1g06990	38.800%	Swiss-Prot	Medium
`Q8VY93`	Arabidopsis thaliana	sp\|Q8VY93\|GDL66_ARATH GDSL esterase/lipase At4g26790	37.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card