LXL04_034719 | RubberDandelionOmics

Gene overview

LXL04_034719

Reference: OH-1004 Chr: Chr07 Coordinates: 114661764-114667094 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1140 bp · LXL04_034719|LXL04_034719|OH1004|cDNA

ATGAAACATATAATATGGATGGCAGTTAACCTAGTAATACTGATTTTATTGTTGGAAGTTGTGGTCACATGCAATGCACGTGTCGTGGGCGATGCTCAGAAGCTTAGGGATCTTGCAGCCAAGTATAACGTTACATGTATTCTGGTGTTTGGTGATTCGAGTGTTGATCCTGGTAACAACAACGATATTCCGAACACATGGCATAAAGGCAATTTCCTACCTTATGGAAAAGATTTCGATCATTCAAACCCAATGGGAAG...

CDS

Download CDS FASTA

1140 bp · LXL04_034719|LXL04_034719|OH1004|CDS

ATGAAACATATAATATGGATGGCAGTTAACCTAGTAATACTGATTTTATTGTTGGAAGTTGTGGTCACATGCAATGCACGTGTCGTGGGCGATGCTCAGAAGCTTAGGGATCTTGCAGCCAAGTATAACGTTACATGTATTCTGGTGTTTGGTGATTCGAGTGTTGATCCTGGTAACAACAACGATATTCCGAACACATGGCATAAAGGCAATTTCCTACCTTATGGAAAAGATTTCGATCATTCAAACCCAATGGGAAG...

Protein

Download Protein FASTA

379 aa · LXL04_034719|LXL04_034719|OH1004|PROTEIN

MKHIIWMAVNLVILILLLEVVVTCNARVVGDAQKLRDLAAKYNVTCILVFGDSSVDPGNNNDIPNTWHKGNFLPYGKDFDHSNPMGRFTNSRLSTDMIAEALDYTNLIKAYLDPSLMDEDLLHGVSFASGGSGYDDFTADNITNVISLRKQLSYFREYKIRLRKLVGEETCARIVENAVFVLSMGTNDFLQNYYIDPTRSQAFTIAQYQGFLINCMETYVQEMHSLGVTRLMVVGMEPFGCMPMIKTLRKSVGCDEEMNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034719`
TK1151 ID	TkA08G429040
OH-1004 ID	LXL04_034719
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 85.634 / OH-1004 80.211 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034719

Location Chr07:114661764-114667094 (+)

Description Similar to At5g45950: GDSL esterase/lipase At5g45950

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45950`	GDSL esterase/lipase At5g45950.	No verified direct reference in this release
`At5g45960`	GDSL esterase/lipase At5g45960.	No verified direct reference in this release
`At2g42990`	GDSL esterase/lipase At2g42990.	No verified direct reference in this release
`At2g04570`	GDSL esterase/lipase At2g04570.	No verified direct reference in this release
`At4g26790`	GDSL esterase/lipase At4g26790.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034719 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016042 lipid catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0016297 fatty acyl-[ACP] hydrolase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

KEGG gene cross-reference

ath:AT2G04570

ath:AT2G42990

ath:AT4G26790

ath:AT5G45950

ath:AT5G45960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.363

Rank 1 · LXL04_034719 · OH-1004

Lysosome / Vacuole0.247

Rank 2 · LXL04_034719 · OH-1004

Cytoplasm0.160

Rank 3 · LXL04_034719 · OH-1004

Endoplasmic reticulum0.155

Rank 4 · LXL04_034719 · OH-1004

Cell membrane0.068

Rank 5 · LXL04_034719 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00657.29Lipase_GDSL47-370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034719	`PF00657.29`	Lipase_GDSL	47	370	1.1e-23	85.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ41`	Arabidopsis thaliana	GDSL esterase/lipase At5g45950	48.986%	Swiss-Prot	moderate database homology
`Q9FJ40`	Arabidopsis thaliana	GDSL esterase/lipase At5g45960	38.095%	Swiss-Prot	moderate database homology
`Q67ZI9`	Arabidopsis thaliana	GDSL esterase/lipase At2g42990	37.537%	Swiss-Prot	moderate database homology
`Q9SJB4`	Arabidopsis thaliana	GDSL esterase/lipase At2g04570	35.119%	Swiss-Prot	moderate database homology
`Q8VY93`	Arabidopsis thaliana	GDSL esterase/lipase At4g26790	35.652%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card