RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G428520
Reference: TK1151 Chr: Chr08 Coordinates: 108891974-108899503 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3818 bp · TkA08G428520|TK1151|cDNA

TTTAAACTCACATGCATTTGCAGAGTACCCTTGAGGCCCAGATTTTGCTGCTATCTCACACAGTCACAAGACCAAACATAATCGTGTAATGCACTTCTCATAACAACTCTTCTTTCTCGTGCCATTTATCGAATTGTGTAATTCATGAGCCACAGTTATCAAAGCAATTCTACACTAATCCAGAGAAGGAGGTGAGAAAGATCAAGAGGGTATTTCAGGTGAATTTGTGGTCAAGAACAAAGACACTGGGTAGCCATGGA...

CDS

Download CDS FASTA

3357 bp · TkA08G428520|TK1151|CDS

ATGGAACTATCTTTACAGGTTCAGACACCTCCATATTGTGGAACGACAGCTCCTCACAAAACCCTCGTAAGGATTAAACCCTTTATTGGGTCTCACCCATCCAAAAGATCAAACTTGTTCTCACAGTTTACACAATCATGTTCGTGGTACAAATATTCTGTGATTGCTGGATTTTCGCACCAAATCATGGCAAGTTCAGACTTCTCAAGAAAAAGGCGATATAAAGTGTCAAGCCCAAGGGCAAATGACTCTGCACCCAA...

Protein

Download Protein FASTA

1118 aa · TkA08G428520|TK1151|PROTEIN

MELSLQVQTPPYCGTTAPHKTLVRIKPFIGSHPSKRSNLFSQFTQSCSWYKYSVIAGFSHQIMASSDFSRKRRYKVSSPRANDSAPKGFKPKPTNPRKDQRTIEGNQNLNPSITTEFVNPTKKESRTEVKVDTIQQLDVPEFNQRAESVKSDIINKKEKVEAIKNDDDQIEYNKEASRKKKLEIEEKIRKKKVEELRKKEMEANIRIQEIKNLANETFLKGEKVFCYPELVTPDQEIEIFLNRLDSSLFDESSIFIMGAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G428520
TK1151 IDTkA08G428520
OH-1004 IDLXL04_035352
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)30.400
Protein coverage (%)TK1151 44.365 / OH-1004 86.314
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G428520
LocationChr08:108891974-108899503 (+)
DescriptionSimilar to Soluble starch synthase 1, chloroplastic/amyloplastic
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g11720 Involved in the synthesis of glycan chains within amylopectin in leaves. No verified direct reference in this release
At4g18240 Probably involved in the priming of starch granule formation. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os08g0191433 Involved in starch synthesis in endosperm amyloplasts.
Knockout of a starch synthase gene OsSSIIIa/Flo5 causes white-core floury endosperm in rice (Oryza sativa L.).2007 · DOI: 10.1007/s00299-007-0309-8
Characterization of SSIIIa-deficient mutants of rice: the function of SSIIIa and pleiotropic effects by SSIIIa deficiency in the rice endosperm.2007 · DOI: 10.1104/pp.107.102533
Structures of starches from rice mutants deficient in the starch synthase isozyme SSI or SSIIIa.2011 · DOI: 10.1021/bm200019q
Double repression of soluble starch synthase genes SSIIa and SSIIIa in rice (Oryza sativa L.) uncovers interactive effects on the physicochemical properties of starch.2011 · DOI: 10.1139/g11-010
Starch biosynthesis in rice endosperm requires the presence of either starch synthase I or IIIa.2011 · DOI: 10.1093/jxb/err125
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_035352 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009960 endosperm development Biological Process
GO:0010021 amylopectin biosynthetic process Biological Process
GO:0019252 starch biosynthetic process Biological Process
GO:0009501 amyloplast Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009536 plastid Cellular Component
GO:0009570 chloroplast stroma Cellular Component
GO:0004373 alpha-1,4-glucan glucosyltransferase (UDP-glucose donor) activity Molecular Function
GO:0009011 alpha-1,4-glucan glucosyltransferase (ADP-glucose donor) activity Molecular Function
KEGG gene cross-reference
ath:AT5G24300
sot:102600045
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.913
Rank 1 · TkA08G428520 · TK1151
Cytoplasm0.056
Rank 2 · TkA08G428520 · TK1151
Mitochondrion0.047
Rank 3 · TkA08G428520 · TK1151
Peroxisome0.039
Rank 4 · TkA08G428520 · TK1151
Cell membrane0.039
Rank 5 · TkA08G428520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16760CBM53238-297 aa
PF25419Ig_PIFI275-305 aa
PF12158DUF3592403-418 aa
PF25419Ig_PIFI408-437 aa
PF16760CBM53412-474 aa
PF12158DUF3592563-582 aa
PF25419Ig_PIFI569-620 aa
PF16760CBM53574-636 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G428520PF16760CBM532382971.5e-38131.6
TkA08G428520PF25419Ig_PIFI2753050.009816.9
TkA08G428520PF12158DUF35924034180.05914.8
TkA08G428520PF25419Ig_PIFI4084370.009816.9
TkA08G428520PF16760CBM534124741.5e-38131.6
TkA08G428520PF12158DUF35925635820.05914.8
TkA08G428520PF25419Ig_PIFI5696200.009816.9
TkA08G428520PF16760CBM535746361.5e-38131.6
TkA08G428520PF08323Glyco_transf_56718595.3e-49167.8
TkA08G428520PF13439Glyco_transf_46858813.7e-1040.8
TkA08G428520PF13579Glyco_trans_4_46868320.0001123.3
TkA08G428520PF00534Glycos_transf_191710417.5e-0626.3
TkA08G428520PF13692Glyco_trans_1_492310403.8e-0524.7
TkA08G428520PF13439Glyco_transf_494910093.7e-1040.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4IAG2Arabidopsis thalianasp|F4IAG2|SSY3_ARATH Starch synthase 3, chloroplastic/amyloplastic65.200%Swiss-ProtHigh
Q0WVX5Arabidopsis thalianasp|Q0WVX5|SSY4_ARATH Probable starch synthase 4, chloroplastic/amyloplastic45.500%Swiss-ProtLow
A0A0P0XCU3Oryza sativa subsp. japonicasp|A0A0P0XCU3|SSY3A_ORYSJ Soluble starch synthase 3a, chloroplastic/amyloplastic61.700%Swiss-ProtHigh

JBrowse

View in Genome Browser