Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2901 bp · TkA08G426680|TK1151|cDNA
ATGTACCCGATCCGTTACTTAGCCCGAAACAGAAAATTACTTCTTCCCTTTCTTCTGTCCCAAATTTGTGTTGTACGGCATCCCTCTTTTTATCTCCTTCGCGCTCCCTGAATTTCTCTCTCACATCGTCGGAGACGAAACGGGCTCTAGGGTTCAAGCAGTCTCTTCCCACCGTGCAATCGGTGATTCCATCTCATTAAAAAGCAACAAGTTCAAGACTCTAGAGATTGAAGTGCTTTATGACAACAAACTGACCAGAA...
2367 bp · TkA08G426680|TK1151|CDS
ATGAGTTATGAAACTGATGACGATGATAAACCCTTGGTTTTTAGAAGGAATGCGAGACCTGATACAGTGAAGCCTTCTCCTCAGCCTTCTTCTAAACCAAGCAATGAAGATGTGGATTCTGAAGATGATAAACCACTAAGTTGTAAGATTTCAAACGTATCAAAGGGGGACACCAATCATGCTAAAATAGAGCCACCAGGTACAAATGTGTCCCCACTTCCAAAACCATTAGCAAAAGATGAAGAAGAAGATTCTGATGA...
Protein
Download Protein FASTA788 aa · TkA08G426680|TK1151|PROTEIN
MSYETDDDDKPLVFRRNARPDTVKPSPQPSSKPSNEDVDSEDDKPLSCKISNVSKGDTNHAKIEPPGTNVSPLPKPLAKDEEEDSDDEKPLSLKYMSKSKVGSSNNHKPHQNGSASNNHNQVKNIGLNKRPPDEERSASVKKPKLSDSVTPVNHKPVASKAETKSDDDDDDDDVPISQRIKKQTASGSNKSSPSVKQKAVVKKSSSSLNQTNKKSKKMMKQKQKQKESKYSKPSRMPPGSGEGQKWTSLVHSGVIFPPEY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G426680 |
|---|---|
| TK1151 ID | TkA08G426680 |
| OH-1004 ID | LXL04_034710 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 97.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G426680 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:108406382-108411530 (+) | |||||||||
| Description | Similar to TOP1A: DNA topoisomerase 1 alpha | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006260 DNA replication Biological Process GO:0006265 DNA topological change Biological Process GO:0006338 chromatin remodeling Biological Process GO:0007059 chromosome segregation Biological Process GO:0009791 post-embryonic development Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0009933 meristem structural organization Biological Process GO:0009965 leaf morphogenesis Biological Process GO:0010016 shoot system morphogenesis Biological Process GO:0010075 regulation of meristem growth Biological Process GO:0019827 stem cell population maintenance Biological Process GO:0030261 chromosome condensation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT5G55300 ath:AT5G55310 ddi:DDB_G0283205 dme:Dmel_CG6146 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF26030RUNDC1189-225 aaPF14362DUF4407189-228 aaPF15456Uds1192-224 aaPF01028Topoisom_I196-227 aaPF02919Topoisom_I_N202-231 aaPF14370Topo_C_assoc214-227 aaPF02919Topoisom_I_N244-456 aaPF13464RodZ_C262-285 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G426680 | PF26030 | RUNDC1 | 189 | 225 | 6.9 | 8.0 |
| TkA08G426680 | PF14362 | DUF4407 | 189 | 228 | 8.1 | 6.3 |
| TkA08G426680 | PF15456 | Uds1 | 192 | 224 | 0.052 | 14.5 |
| TkA08G426680 | PF01028 | Topoisom_I | 196 | 227 | 5.4e-94 | 314.5 |
| TkA08G426680 | PF02919 | Topoisom_I_N | 202 | 231 | 3.4e-94 | 315.0 |
| TkA08G426680 | PF14370 | Topo_C_assoc | 214 | 227 | 2.7e-33 | 114.3 |
| TkA08G426680 | PF02919 | Topoisom_I_N | 244 | 456 | 3.4e-94 | 315.0 |
| TkA08G426680 | PF13464 | RodZ_C | 262 | 285 | 0.077 | 13.7 |
| TkA08G426680 | PF15456 | Uds1 | 330 | 363 | 0.052 | 14.5 |
| TkA08G426680 | PF14370 | Topo_C_assoc | 359 | 367 | 2.7e-33 | 114.3 |
| TkA08G426680 | PF13464 | RodZ_C | 424 | 434 | 0.077 | 13.7 |
| TkA08G426680 | PF01028 | Topoisom_I | 459 | 684 | 5.4e-94 | 314.5 |
| TkA08G426680 | PF26030 | RUNDC1 | 491 | 517 | 6.9 | 8.0 |
| TkA08G426680 | PF12841 | YvrJ | 502 | 509 | 6.6 | 7.1 |
| TkA08G426680 | PF15456 | Uds1 | 620 | 689 | 0.052 | 14.5 |
| TkA08G426680 | PF14362 | DUF4407 | 645 | 732 | 8.1 | 6.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.