LXL04_034710 | RubberDandelionOmics

Gene overview

LXL04_034710

Reference: OH-1004 Chr: Chr07 Coordinates: 114455627-114459544 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2361 bp · LXL04_034710|LXL04_034710|OH1004|cDNA

ATGAGTTATGAATCCGATGACGATGATAAACCCTTGGTTTTTAGAAGGAATGCGAGACCTGATACAGTGAAGCCTTCTCCTCAGCCTTCTTCTAAACCAAGCAATGAAGATGTGGATTCTGAAGATGATAAACCACTAAGTTGTAAGATTTCAAATGTATCAAAGGGGGACACCAATCATGCTAAAATAGAGCCACCAGGTACAAATGTGTCCCCACTTCTAAAACCATTAgcaaaagatgaagaagaagattcTGATGA...

CDS

Download CDS FASTA

2361 bp · LXL04_034710|LXL04_034710|OH1004|CDS

ATGAGTTATGAATCCGATGACGATGATAAACCCTTGGTTTTTAGAAGGAATGCGAGACCTGATACAGTGAAGCCTTCTCCTCAGCCTTCTTCTAAACCAAGCAATGAAGATGTGGATTCTGAAGATGATAAACCACTAAGTTGTAAGATTTCAAATGTATCAAAGGGGGACACCAATCATGCTAAAATAGAGCCACCAGGTACAAATGTGTCCCCACTTCTAAAACCATTAGCAAAAGATGAAGAAGAAGATTCTGATGA...

Protein

Download Protein FASTA

786 aa · LXL04_034710|LXL04_034710|OH1004|PROTEIN

MSYESDDDDKPLVFRRNARPDTVKPSPQPSSKPSNEDVDSEDDKPLSCKISNVSKGDTNHAKIEPPGTNVSPLLKPLAKDEEEDSDDEKPLSLKYMSKSKVGSSNNHKPHQNGSASNNHNQVKNIGLNKRPPDEERSASVKKPKLSDSVTPVNHKPVALKAETKSDDDHDDDDVPISQRIKKQTASGSNNPSPSVKQKAVVKKSSSSLNQTNKKSKKMMKQKQKESKYSKPSRMPPGSGEGQKWTSLVHSGVIFPPEYKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034710`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034710

Location Chr07:114455627-114459544 (+)

Description Similar to TOP1A: DNA topoisomerase 1 alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55300`	Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex.	Disruption of a DNA topoisomerase I gene affects morphogenesis in Arabidopsis.2002 · DOI: 10.1105/tpc.001925 MGOUN1 encodes an Arabidopsis type IB DNA topoisomerase required in stem cell regulation and to maintain developmentally regulated gene silencing.2010 · DOI: 10.1105/tpc.109.068296
`At5g55310`	Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex.	Disruption of a DNA topoisomerase I gene affects morphogenesis in Arabidopsis.2002 · DOI: 10.1105/tpc.001925

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034710 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006265 DNA topological change Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0030261 chromosome condensation Biological Process

KEGG gene cross-reference

ath:AT5G55300

ath:AT5G55310

ddi:DDB_G0283205

dme:Dmel_CG6146

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.811

Rank 1 · LXL04_034710 · OH-1004

Cytoplasm0.199

Rank 2 · LXL04_034710 · OH-1004

Mitochondrion0.053

Rank 3 · LXL04_034710 · OH-1004

Cell membrane0.049

Rank 4 · LXL04_034710 · OH-1004

Endoplasmic reticulum0.039

Rank 5 · LXL04_034710 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02919.21Topoisom_I_N242-454 aa

PF01028.26Topoisom_I457-682 aa

PF14370.12Topo_C_assoc717-786 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034710	`PF02919.21`	Topoisom_I_N	242	454	3.4e-94	315.0
LXL04_034710	`PF01028.26`	Topoisom_I	457	682	6.8e-94	314.2
LXL04_034710	`PF14370.12`	Topo_C_assoc	717	786	2.4e-33	114.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P30181`	Arabidopsis thaliana	DNA topoisomerase 1 alpha	60.558%	Swiss-Prot	strong database homology
`Q9FJ79`	Arabidopsis thaliana	DNA topoisomerase 1 beta	62.753%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card