TkA08G407900 | RubberDandelionOmics

Gene overview

TkA08G407900

Reference: TK1151 Chr: Chr08 Coordinates: 103849899-103851616 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1277 bp · TkA08G407900|TK1151|cDNA

TATTTGTTTATTTTGCTGAAAAGATATATCACCATGCCAAATTAAAGTGTGAGGGCAGGAGCATTATCACAGAGAATGTTGCAGGGAAAAAAAATTAAAACACTCCATGAACACAACTCAAAGGACTGAGATTCAGGAGGAGGAGAGAGAAATCAAAGTGGCGGGAGACAGAAAGTAGAAAACAGAAACGCCACAAAGATGGTCGCGAATGAGTTTTTCTGGTCGAATTCAGATGAACCACACGCTTCTCGCCGTCGTCA...

CDS

Download CDS FASTA

615 bp · TkA08G407900|TK1151|CDS

ATGTCCGTCACTTTCCAGAAATATCACCTTGAGCACCACCGTTACCAAGGCGTTGATGGGGTTGACACTGACGTTCCTACCCTAATAGAAGCACGCCTGGTAAAAAATATGGTCACCAAATGCATATGGGTACTCTTCCAACTATTATTTTACGCCATCAGACCGTTACTAGTGAAGCCTAAACGACTTGGAAAATGGGAATTCTTGAATCTCATCATCCAAATCGGACTTGATGCTTATATAATTTGCTTCTTGGGGTG...

Protein

Download Protein FASTA

204 aa · TkA08G407900|TK1151|PROTEIN

MSVTFQKYHLEHHRYQGVDGVDTDVPTLIEARLVKNMVTKCIWVLFQLLFYAIRPLLVKPKRLGKWEFLNLIIQIGLDAYIICFLGWRSFGYLILSTFVGGGMHPMAGHFISEHYVFNKKEGQETYSYYGPLNIMSWHVGYHNEHHDFPRIPGCKLHKVREIAPEYYENLESYGSWSQVIYSYIADKSLGPFSRMKRKLSTKIT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G407900`
TK1151 ID	TkA08G407900
OH-1004 ID	LXL04_034485
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 64.353 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G407900

Location Chr08:103849899-103851616 (+)

Description Similar to At4g04930: Sphingolipid delta(4)-desaturase DES1-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04930`	Sphingolipid-delta-4-desaturase required for the biosynthesis of delta-4-unsaturated sphingolipids and derivatives.	Functional characterization of a higher plant sphingolipid Delta4-desaturase: defining the role of sphingosine and sphingosine-1-phosphate in Arabidopsis.2009 · DOI: 10.1104/pp.108.129411

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0639600`	Sphingolipid-delta-4-desaturase required for the biosynthesis of delta-4-unsaturated sphingolipids and derivatives.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034485 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006686 sphingomyelin biosynthetic process Biological Process

GO:0006688 glycosphingolipid biosynthetic process Biological Process

GO:0030148 sphingolipid biosynthetic process Biological Process

GO:0046513 ceramide biosynthetic process Biological Process

GO:1904503 negative regulation of lipophagy Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0098554 cytoplasmic side of endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT4G04930

bta:507290

dme:Dmel_CG9078

dosa:Os02g0639600

xtr:493214

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.895

Rank 1 · TkA08G407900 · TK1151

Mitochondrion0.058

Rank 2 · TkA08G407900 · TK1151

Cytoplasm0.055

Rank 3 · TkA08G407900 · TK1151

Cell membrane0.044

Rank 4 · TkA08G407900 · TK1151

Nucleus0.035

Rank 5 · TkA08G407900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00487FA_desaturase4-171 aa

PF13994PgaD30-61 aa

PF13994PgaD81-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G407900	`PF00487`	FA_desaturase	4	171	1.4e-18	68.3
TkA08G407900	`PF13994`	PgaD	30	61	3.6	8.2
TkA08G407900	`PF13994`	PgaD	81	99	3.6	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPH4`	Arabidopsis thaliana	sp\|Q9ZPH4\|DES1L_ARATH Sphingolipid delta(4)-desaturase DES1-like	74.000%	Swiss-Prot	High
`Q6H5U3`	Oryza sativa subsp. japonica	sp\|Q6H5U3\|DES1L_ORYSJ Sphingolipid delta(4)-desaturase DES1-like	73.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card