Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1076 bp · LXL04_034485|LXL04_034485|OH1004|cDNA
ATGTTgcagaaaaaaaaattaaaacactCCATGAACACAACTCAAAGGACTGAGATTCAGGAGGAGGAGAGAGAAATCACGGTGGCGGGAGACAGAAAGTAGAAAACAGAAACGCCCCAACGATGGTGGCGAATGAGTTTTTCTGGTCGTATTTAGATGAACCACACGCTTCTCGCCGCCGTCAGATCCTCGCCCAGTATCCCCAGATCAGACAACTCTTTGGTCCTGATCCCTGGGCTCTCCTCAAGGTAACTCTTGTT...
954 bp · LXL04_034485|LXL04_034485|OH1004|CDS
ATGGTGGCGAATGAGTTTTTCTGGTCGTATTTAGATGAACCACACGCTTCTCGCCGCCGTCAGATCCTCGCCCAGTATCCCCAGATCAGACAACTCTTTGGTCCTGATCCCTGGGCTCTCCTCAAGGTAACTCTTGTTGTTTCGCTTCAACTATGGACCGCCGTATACCTCCACGACGCTGGGTGGAGGGAGATACTCACAGTCGCCTACTTTTTTGGATCTTTTCTTAATCACAATCTTTTCTTAGCCATCCATGAATT...
Protein
Download Protein FASTA317 aa · LXL04_034485|LXL04_034485|OH1004|PROTEIN
MVANEFFWSYLDEPHASRRRQILAQYPQIRQLFGPDPWALLKVTLVVSLQLWTAVYLHDAGWREILTVAYFFGSFLNHNLFLAIHELSHNLAFSNPLYNRCLGIFANLPIGVPMSVTFQKYHLEHHRYQGVDGIDTDVPTLIEARLVKNMVTKCIWVLLQLFFYAVRPLLVKPKRPGKWEFLNLIIQIGLDAYIICFLGWRSFGYLILSTFVGGGMHPMAGHFISEHYVFNKKEGQETYSYYGPLNIMSWHVGYHNEHHD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_034485 |
|---|---|
| TK1151 ID | TkA08G407900 |
| OH-1004 ID | LXL04_034485 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 96.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 64.353Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_034485 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:102631159-102632674 (-) | ||||||||||||
| Description | Similar to At4g04930: Sphingolipid delta(4)-desaturase DES1-like | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006633 fatty acid biosynthetic process Biological Process GO:0006686 sphingomyelin biosynthetic process Biological Process GO:0006688 glycosphingolipid biosynthetic process Biological Process GO:0030148 sphingolipid biosynthetic process Biological Process GO:0046513 ceramide biosynthetic process Biological Process GO:1904503 negative regulation of lipophagy Biological Process GO:0005739 mitochondrion Cellular Component GO:0005770 late endosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0031966 mitochondrial membrane Cellular Component GO:0098554 cytoplasmic side of endoplasmic reticulum membrane Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT4G04930 bta:507290 dme:Dmel_CG9078 dosa:Os02g0639600 xtr:493214 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08557.16Lipid_DES3-38 aaPF00487.31FA_desaturase68-284 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_034485 | PF08557.16 | Lipid_DES | 3 | 38 | 2.3e-18 | 66.1 |
| LXL04_034485 | PF00487.31 | FA_desaturase | 68 | 284 | 4.8e-25 | 89.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.